Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2PSP4

Protein Details
Accession E2PSP4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
103-131KAGMTGLKKRDRKKGKAKGKKEGGKVVKGBasic
NLS Segment(s)
PositionSequence
109-131LKKRDRKKGKAKGKKEGGKVVKG
Subcellular Location(s) cyto 13.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003210  Signal_recog_particle_SRP14  
IPR009018  Signal_recog_particle_SRP9/14  
Gene Ontology GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0030942  F:endoplasmic reticulum signal peptide binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
KEGG ang:ANI_1_1852064  -  
Pfam View protein in Pfam  
PF02290  SRP14  
Amino Acid Sequences MPAHLGHEEFFTSLTTLLSTTSQKTRGSVYLTQKPLLDSTNTQSQPSILIRATDGNTNAPNPKTAEAKKKVSKATAASKVKISTVVSPDDLEAFYARYAEVCKAGMTGLKKRDRKKGKAKGKKEGGKVVKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.08
4 0.08
5 0.1
6 0.11
7 0.14
8 0.18
9 0.22
10 0.23
11 0.24
12 0.26
13 0.27
14 0.31
15 0.34
16 0.38
17 0.43
18 0.45
19 0.45
20 0.42
21 0.4
22 0.36
23 0.3
24 0.25
25 0.18
26 0.2
27 0.27
28 0.27
29 0.27
30 0.25
31 0.24
32 0.24
33 0.23
34 0.21
35 0.12
36 0.12
37 0.12
38 0.14
39 0.15
40 0.14
41 0.14
42 0.13
43 0.13
44 0.14
45 0.16
46 0.14
47 0.15
48 0.14
49 0.16
50 0.19
51 0.22
52 0.3
53 0.33
54 0.41
55 0.45
56 0.49
57 0.49
58 0.46
59 0.45
60 0.41
61 0.43
62 0.46
63 0.44
64 0.4
65 0.39
66 0.38
67 0.35
68 0.32
69 0.25
70 0.19
71 0.18
72 0.19
73 0.17
74 0.17
75 0.17
76 0.15
77 0.14
78 0.11
79 0.09
80 0.08
81 0.07
82 0.07
83 0.07
84 0.06
85 0.08
86 0.09
87 0.1
88 0.09
89 0.09
90 0.09
91 0.1
92 0.13
93 0.16
94 0.22
95 0.3
96 0.39
97 0.46
98 0.52
99 0.63
100 0.69
101 0.76
102 0.8
103 0.82
104 0.84
105 0.88
106 0.91
107 0.91
108 0.92
109 0.9
110 0.86
111 0.86