Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A2R9F7

Protein Details
Accession A2R9F7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
90-109VTILSRKRGRIRPSTPHPLSHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 15, mito 8, cyto 2.5, cyto_nucl 2.5
Family & Domain DBs
Amino Acid Sequences SILARLVGWGATLGTLGEGKGNKPTQPAAMARKWANEREPPTSPWFQGGWPAGQSRVFITVFMHTPDSPIGPSACEDGTRQPPFPLWSVVTILSRKRGRIRPSTPHPLSAPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.05
4 0.08
5 0.09
6 0.1
7 0.17
8 0.19
9 0.2
10 0.22
11 0.24
12 0.23
13 0.27
14 0.31
15 0.31
16 0.32
17 0.37
18 0.35
19 0.39
20 0.4
21 0.39
22 0.38
23 0.39
24 0.39
25 0.4
26 0.42
27 0.39
28 0.41
29 0.4
30 0.36
31 0.31
32 0.28
33 0.22
34 0.24
35 0.22
36 0.17
37 0.16
38 0.16
39 0.14
40 0.14
41 0.14
42 0.1
43 0.11
44 0.1
45 0.09
46 0.1
47 0.1
48 0.1
49 0.11
50 0.13
51 0.1
52 0.1
53 0.11
54 0.11
55 0.09
56 0.1
57 0.09
58 0.07
59 0.08
60 0.09
61 0.09
62 0.09
63 0.1
64 0.15
65 0.23
66 0.25
67 0.25
68 0.24
69 0.26
70 0.28
71 0.29
72 0.27
73 0.2
74 0.19
75 0.2
76 0.21
77 0.22
78 0.23
79 0.24
80 0.29
81 0.31
82 0.34
83 0.42
84 0.48
85 0.52
86 0.6
87 0.66
88 0.68
89 0.74
90 0.8
91 0.74
92 0.72