Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LDB0

Protein Details
Accession E2LDB0   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
6-29SSDAWWSRTRRAKHKRDLAHQVWEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, mito_nucl 13, mito 5.5
Family & Domain DBs
KEGG mpr:MPER_04253  -  
Amino Acid Sequences MPTTVSSDAWWSRTRRAKHKRDLAHQVWEIRDSVPESFLERSNPLKDRPDLRDKSMDFVICDITSCNLAQVKCKLAEIWLELYGVKTIGGLRKKIIQGYVEEGEVEEEFDDEDNKKPRTQEYVPFSHRPGTFLETFMLMMQLCHKPFPSETTDQPPIVRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.57
3 0.65
4 0.72
5 0.77
6 0.84
7 0.84
8 0.85
9 0.88
10 0.82
11 0.8
12 0.73
13 0.67
14 0.58
15 0.5
16 0.42
17 0.31
18 0.29
19 0.21
20 0.18
21 0.14
22 0.14
23 0.15
24 0.16
25 0.17
26 0.17
27 0.18
28 0.21
29 0.25
30 0.27
31 0.28
32 0.32
33 0.35
34 0.39
35 0.43
36 0.5
37 0.48
38 0.49
39 0.54
40 0.49
41 0.48
42 0.44
43 0.38
44 0.28
45 0.25
46 0.23
47 0.14
48 0.14
49 0.11
50 0.08
51 0.08
52 0.08
53 0.09
54 0.1
55 0.1
56 0.13
57 0.15
58 0.17
59 0.16
60 0.17
61 0.15
62 0.13
63 0.15
64 0.13
65 0.13
66 0.1
67 0.1
68 0.1
69 0.1
70 0.09
71 0.08
72 0.06
73 0.04
74 0.05
75 0.1
76 0.13
77 0.13
78 0.14
79 0.19
80 0.2
81 0.21
82 0.22
83 0.19
84 0.18
85 0.22
86 0.22
87 0.17
88 0.16
89 0.14
90 0.13
91 0.12
92 0.1
93 0.05
94 0.04
95 0.05
96 0.05
97 0.06
98 0.07
99 0.12
100 0.18
101 0.19
102 0.21
103 0.23
104 0.26
105 0.32
106 0.36
107 0.4
108 0.41
109 0.48
110 0.52
111 0.54
112 0.53
113 0.52
114 0.48
115 0.4
116 0.37
117 0.33
118 0.28
119 0.26
120 0.26
121 0.19
122 0.19
123 0.18
124 0.16
125 0.1
126 0.09
127 0.12
128 0.17
129 0.17
130 0.18
131 0.19
132 0.21
133 0.22
134 0.27
135 0.3
136 0.3
137 0.35
138 0.42
139 0.47
140 0.45