Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397TAZ6

Protein Details
Accession A0A397TAZ6    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
95-119TVTIEERRPKDRNRKGKGRNISDVIHydrophilic
NLS Segment(s)
PositionSequence
101-113RRPKDRNRKGKGR
Subcellular Location(s) nucl 14.5, mito_nucl 12.833, cyto_nucl 9.666, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
Amino Acid Sequences MASSKNYRTTNVPSSNQVVETKRGGRLNKEFSLYIKGIVSGMDKNVLNNVFTTFGAVKSLDVVPSKSCAFVEFFTKEAYEQALMQKMISVPDLGTVTIEERRPKDRNRKGKGRNISDVIST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.49
3 0.46
4 0.43
5 0.36
6 0.32
7 0.34
8 0.32
9 0.34
10 0.37
11 0.37
12 0.4
13 0.46
14 0.49
15 0.47
16 0.47
17 0.42
18 0.39
19 0.42
20 0.35
21 0.28
22 0.21
23 0.18
24 0.15
25 0.15
26 0.15
27 0.09
28 0.09
29 0.11
30 0.11
31 0.11
32 0.14
33 0.14
34 0.12
35 0.12
36 0.12
37 0.1
38 0.1
39 0.12
40 0.09
41 0.09
42 0.1
43 0.09
44 0.08
45 0.08
46 0.09
47 0.08
48 0.08
49 0.09
50 0.09
51 0.11
52 0.11
53 0.1
54 0.1
55 0.09
56 0.11
57 0.11
58 0.15
59 0.14
60 0.14
61 0.14
62 0.15
63 0.14
64 0.13
65 0.13
66 0.09
67 0.09
68 0.11
69 0.14
70 0.13
71 0.13
72 0.14
73 0.13
74 0.13
75 0.13
76 0.11
77 0.07
78 0.1
79 0.1
80 0.09
81 0.09
82 0.08
83 0.1
84 0.13
85 0.17
86 0.2
87 0.22
88 0.3
89 0.36
90 0.45
91 0.55
92 0.62
93 0.69
94 0.74
95 0.82
96 0.85
97 0.89
98 0.9
99 0.87
100 0.85
101 0.79