Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397S931

Protein Details
Accession A0A397S931    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
146-171EDKNQEIVRNEKKRKESRKILLNYLVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
Amino Acid Sequences MNFQKSEIFQWNGKSYRIVDNIGFGDNNFTSEADILHRIGEGIYSTKEGINQVLFVFGGRFSEEQVIAFNMFKKFISESRITEFTTLVRTNFPNFRNQKKCEDDRETLLAQNKELREIIESCKGIVYVDNPAIPVIEDEDSEDEIEDKNQEIVRNEKKRKESRKILLNYLVENCQNIYKLKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.36
3 0.4
4 0.4
5 0.37
6 0.3
7 0.31
8 0.31
9 0.3
10 0.27
11 0.18
12 0.2
13 0.17
14 0.18
15 0.14
16 0.13
17 0.12
18 0.12
19 0.13
20 0.1
21 0.12
22 0.11
23 0.1
24 0.1
25 0.1
26 0.09
27 0.09
28 0.08
29 0.08
30 0.08
31 0.09
32 0.1
33 0.1
34 0.12
35 0.12
36 0.13
37 0.11
38 0.11
39 0.1
40 0.1
41 0.09
42 0.08
43 0.08
44 0.06
45 0.06
46 0.07
47 0.07
48 0.07
49 0.09
50 0.09
51 0.09
52 0.1
53 0.1
54 0.1
55 0.1
56 0.12
57 0.1
58 0.11
59 0.11
60 0.11
61 0.12
62 0.13
63 0.18
64 0.18
65 0.2
66 0.23
67 0.25
68 0.24
69 0.23
70 0.21
71 0.17
72 0.18
73 0.17
74 0.13
75 0.13
76 0.13
77 0.16
78 0.21
79 0.21
80 0.26
81 0.3
82 0.39
83 0.45
84 0.48
85 0.53
86 0.55
87 0.59
88 0.58
89 0.6
90 0.53
91 0.49
92 0.5
93 0.42
94 0.38
95 0.39
96 0.31
97 0.25
98 0.26
99 0.23
100 0.2
101 0.2
102 0.17
103 0.14
104 0.16
105 0.18
106 0.21
107 0.21
108 0.19
109 0.19
110 0.19
111 0.16
112 0.15
113 0.13
114 0.11
115 0.12
116 0.12
117 0.12
118 0.12
119 0.12
120 0.11
121 0.1
122 0.08
123 0.07
124 0.07
125 0.08
126 0.1
127 0.11
128 0.1
129 0.1
130 0.09
131 0.09
132 0.1
133 0.09
134 0.08
135 0.1
136 0.12
137 0.15
138 0.17
139 0.26
140 0.36
141 0.45
142 0.53
143 0.58
144 0.66
145 0.74
146 0.81
147 0.83
148 0.84
149 0.83
150 0.85
151 0.83
152 0.8
153 0.78
154 0.71
155 0.64
156 0.56
157 0.51
158 0.41
159 0.36
160 0.3
161 0.25
162 0.24