Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397T0U2

Protein Details
Accession A0A397T0U2   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
96-128WDQRNSFKKSSNHHRNRSKSPSRRNDRNRSHYYHydrophilic
NLS Segment(s)
PositionSequence
103-119KKSSNHHRNRSKSPSRR
Subcellular Location(s) nucl 19, cyto_nucl 12.5, cyto 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR008111  RNA-bd_8  
IPR000504  RRM_dom  
IPR033744  RRM_RBM8  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0003729  F:mRNA binding  
GO:0006396  P:RNA processing  
Pfam View protein in Pfam  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
CDD cd12324  RRM_RBM8  
Amino Acid Sequences KAIDGWIVLVTNVHEEATEEDVMNKFSQYGKINNLQLSIDRRTGYVKGYVLIAYGTYEEAMFAIEKANGSKLLGQRLYCDFAFIRPPPLNNNKKPWDQRNSFKKSSNHHRNRSKSPSRRNDRNRSHYY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.11
4 0.14
5 0.14
6 0.12
7 0.13
8 0.14
9 0.16
10 0.15
11 0.13
12 0.1
13 0.11
14 0.17
15 0.18
16 0.21
17 0.25
18 0.31
19 0.34
20 0.34
21 0.34
22 0.29
23 0.29
24 0.3
25 0.28
26 0.24
27 0.21
28 0.2
29 0.22
30 0.22
31 0.2
32 0.19
33 0.16
34 0.14
35 0.15
36 0.14
37 0.12
38 0.11
39 0.09
40 0.06
41 0.05
42 0.05
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.03
50 0.04
51 0.04
52 0.05
53 0.05
54 0.06
55 0.06
56 0.06
57 0.1
58 0.11
59 0.16
60 0.18
61 0.17
62 0.19
63 0.21
64 0.24
65 0.2
66 0.2
67 0.15
68 0.15
69 0.2
70 0.18
71 0.22
72 0.2
73 0.22
74 0.27
75 0.38
76 0.45
77 0.46
78 0.55
79 0.54
80 0.62
81 0.7
82 0.71
83 0.71
84 0.69
85 0.73
86 0.75
87 0.78
88 0.74
89 0.73
90 0.71
91 0.7
92 0.75
93 0.76
94 0.76
95 0.78
96 0.83
97 0.84
98 0.87
99 0.88
100 0.88
101 0.87
102 0.88
103 0.88
104 0.89
105 0.91
106 0.92
107 0.92
108 0.92