Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TKZ1

Protein Details
Accession A0A397TKZ1    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MSQRSIKKERHFARPGRYFLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10.5, cyto_mito 7.166, nucl 7, cyto_nucl 5.833, pero 3, cyto 2.5, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013632  DNA_recomb/repair_Rad51_C  
IPR027417  P-loop_NTPase  
IPR047323  Rad51D_C  
IPR020588  RecA_ATP-bd  
Gene Ontology GO:0005634  C:nucleus  
GO:0005524  F:ATP binding  
GO:0140664  F:ATP-dependent DNA damage sensor activity  
GO:0003677  F:DNA binding  
GO:0016787  F:hydrolase activity  
GO:0006310  P:DNA recombination  
GO:0006281  P:DNA repair  
GO:0061982  P:meiosis I cell cycle process  
Pfam View protein in Pfam  
PF08423  Rad51  
PROSITE View protein in PROSITE  
PS50162  RECA_2  
CDD cd19489  Rad51D  
Amino Acid Sequences MSQRSIKKERHFARPGRYFLFRKEILSTISPKRGNNLLETPQTSVLSTGCYGIDELLQGGLHPGEITEISGETATGKTQLAFSTTLTTLCANKDNKVLFIDTVSTFSAERMRMLFLESDRFEEEDVMNRIRIVKCFNVYSVMEFIEDLRDHLENKDKNDNIYTNIKLIIIDSFAAILAPLLGVTQTQGHSLMVTFTRILRNLAKEYDIAILVINAAIASYPNNPISVFSSTKSKPSLGISWTFMPNIQLYLTHCIDYTIENGIVIKENEGEKNIQQNYVYTNRKGIEVIMKPRICEVLRSRNGQMGKWCIFYMGGNELFTHYDIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.77
3 0.71
4 0.73
5 0.66
6 0.62
7 0.63
8 0.54
9 0.47
10 0.45
11 0.42
12 0.38
13 0.39
14 0.4
15 0.38
16 0.45
17 0.46
18 0.43
19 0.45
20 0.47
21 0.44
22 0.44
23 0.43
24 0.41
25 0.43
26 0.44
27 0.42
28 0.39
29 0.37
30 0.31
31 0.26
32 0.2
33 0.16
34 0.15
35 0.13
36 0.1
37 0.1
38 0.1
39 0.09
40 0.1
41 0.07
42 0.07
43 0.07
44 0.06
45 0.06
46 0.07
47 0.06
48 0.06
49 0.05
50 0.05
51 0.05
52 0.06
53 0.06
54 0.06
55 0.06
56 0.06
57 0.06
58 0.06
59 0.06
60 0.07
61 0.07
62 0.08
63 0.08
64 0.07
65 0.09
66 0.09
67 0.1
68 0.11
69 0.11
70 0.14
71 0.14
72 0.14
73 0.14
74 0.15
75 0.14
76 0.15
77 0.21
78 0.18
79 0.2
80 0.25
81 0.25
82 0.26
83 0.26
84 0.25
85 0.19
86 0.18
87 0.19
88 0.14
89 0.15
90 0.13
91 0.12
92 0.11
93 0.12
94 0.14
95 0.12
96 0.13
97 0.11
98 0.12
99 0.11
100 0.13
101 0.14
102 0.11
103 0.16
104 0.16
105 0.17
106 0.17
107 0.17
108 0.16
109 0.15
110 0.15
111 0.15
112 0.17
113 0.16
114 0.15
115 0.15
116 0.19
117 0.19
118 0.2
119 0.18
120 0.18
121 0.19
122 0.2
123 0.2
124 0.2
125 0.19
126 0.19
127 0.17
128 0.14
129 0.12
130 0.11
131 0.11
132 0.09
133 0.09
134 0.08
135 0.08
136 0.08
137 0.09
138 0.1
139 0.18
140 0.17
141 0.21
142 0.28
143 0.27
144 0.28
145 0.3
146 0.29
147 0.25
148 0.28
149 0.25
150 0.18
151 0.18
152 0.17
153 0.14
154 0.13
155 0.1
156 0.06
157 0.06
158 0.05
159 0.04
160 0.04
161 0.04
162 0.04
163 0.03
164 0.02
165 0.02
166 0.02
167 0.02
168 0.02
169 0.02
170 0.03
171 0.04
172 0.05
173 0.05
174 0.06
175 0.06
176 0.06
177 0.07
178 0.07
179 0.07
180 0.07
181 0.07
182 0.08
183 0.1
184 0.11
185 0.13
186 0.15
187 0.18
188 0.19
189 0.2
190 0.2
191 0.18
192 0.19
193 0.17
194 0.14
195 0.11
196 0.09
197 0.08
198 0.06
199 0.06
200 0.04
201 0.03
202 0.03
203 0.02
204 0.03
205 0.04
206 0.05
207 0.08
208 0.08
209 0.09
210 0.09
211 0.11
212 0.14
213 0.17
214 0.17
215 0.16
216 0.23
217 0.23
218 0.27
219 0.28
220 0.26
221 0.24
222 0.26
223 0.29
224 0.25
225 0.28
226 0.27
227 0.28
228 0.29
229 0.27
230 0.23
231 0.21
232 0.18
233 0.15
234 0.12
235 0.11
236 0.12
237 0.18
238 0.18
239 0.17
240 0.17
241 0.17
242 0.17
243 0.16
244 0.15
245 0.12
246 0.11
247 0.11
248 0.11
249 0.11
250 0.13
251 0.13
252 0.12
253 0.12
254 0.14
255 0.15
256 0.17
257 0.19
258 0.18
259 0.27
260 0.27
261 0.27
262 0.25
263 0.25
264 0.29
265 0.35
266 0.39
267 0.31
268 0.35
269 0.34
270 0.35
271 0.34
272 0.31
273 0.31
274 0.33
275 0.39
276 0.44
277 0.44
278 0.43
279 0.44
280 0.47
281 0.39
282 0.39
283 0.4
284 0.41
285 0.47
286 0.52
287 0.52
288 0.53
289 0.54
290 0.5
291 0.49
292 0.46
293 0.43
294 0.4
295 0.38
296 0.33
297 0.32
298 0.29
299 0.25
300 0.23
301 0.22
302 0.2
303 0.2
304 0.21
305 0.22