Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TUZ4

Protein Details
Accession A0A397TUZ4   
Localization Confidence High
Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
69-121KYDRRERRSRSPHGRDRDRIRERDRRDRRRTPERSIRHRSRSRSPRRDRGVSPBasic
124-156SERERDRKDDRHDRDRKIRSRSRSPRKEELSNVBasic
NLS Segment(s)
PositionSequence
53-150RRSRSPLGRDRDRDRDKYDRRERRSRSPHGRDRDRIRERDRRDRRRTPERSIRHRSRSRSPRRDRGVSPRGSERERDRKDDRHDRDRKIRSRSRSPRK
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MPRSPSPRTDYSRRHHSRSDYRDREPHYRDRDYHPDSYRDLDRPSEDLYYDRRRSRSPLGRDRDRDRDKYDRRERRSRSPHGRDRDRIRERDRRDRRRTPERSIRHRSRSRSPRRDRGVSPRGSERERDRKDDRHDRDRKIRSRSRSPRKEELSNVPVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.72
3 0.74
4 0.75
5 0.76
6 0.79
7 0.75
8 0.75
9 0.77
10 0.76
11 0.75
12 0.71
13 0.7
14 0.67
15 0.67
16 0.63
17 0.64
18 0.67
19 0.63
20 0.65
21 0.59
22 0.55
23 0.5
24 0.5
25 0.46
26 0.39
27 0.36
28 0.3
29 0.28
30 0.27
31 0.27
32 0.23
33 0.2
34 0.19
35 0.24
36 0.3
37 0.34
38 0.36
39 0.37
40 0.38
41 0.43
42 0.51
43 0.53
44 0.54
45 0.58
46 0.62
47 0.68
48 0.73
49 0.73
50 0.74
51 0.7
52 0.65
53 0.61
54 0.63
55 0.62
56 0.66
57 0.71
58 0.7
59 0.72
60 0.77
61 0.77
62 0.77
63 0.79
64 0.78
65 0.78
66 0.78
67 0.79
68 0.79
69 0.81
70 0.77
71 0.76
72 0.76
73 0.73
74 0.7
75 0.69
76 0.69
77 0.69
78 0.73
79 0.76
80 0.76
81 0.78
82 0.81
83 0.82
84 0.84
85 0.84
86 0.82
87 0.82
88 0.81
89 0.81
90 0.82
91 0.82
92 0.82
93 0.82
94 0.79
95 0.79
96 0.8
97 0.82
98 0.82
99 0.83
100 0.83
101 0.84
102 0.84
103 0.79
104 0.79
105 0.77
106 0.71
107 0.65
108 0.64
109 0.61
110 0.56
111 0.56
112 0.55
113 0.57
114 0.56
115 0.6
116 0.58
117 0.62
118 0.7
119 0.75
120 0.74
121 0.74
122 0.78
123 0.79
124 0.83
125 0.85
126 0.83
127 0.83
128 0.83
129 0.81
130 0.84
131 0.86
132 0.87
133 0.87
134 0.87
135 0.87
136 0.85
137 0.84
138 0.8
139 0.79