Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397S5J7

Protein Details
Accession A0A397S5J7    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
234-253EDMGNVKKRYKELKKIDCSNHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 17.5, cyto_nucl 12.5, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045379  Crinkler_N  
Gene Ontology GO:0005576  C:extracellular region  
Pfam View protein in Pfam  
PF20147  Crinkler  
Amino Acid Sequences MFGITFLCFLQGVEEPFLIAVDETDTINHLKEGILSRRREIIRENAETFKIWKVFIPVNEYNKLRNPPVEIESGEELEGGQRITSIGEVRNEYIQVFMGNPDSVIIPPTLTKQINSFYFDLGVTSIDGAGVELDYYLEEICKLGVIKVGDELRIKKGYGEGKDLKPVKIGCRVIGIDNGIFTITLIGYDKERKIITSLVLLEIWLLNKFNLDKQYRPKYYSRPDENIDIIRNGEDMGNVKKRYKELKKIDCSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.14
4 0.15
5 0.12
6 0.09
7 0.07
8 0.06
9 0.07
10 0.07
11 0.07
12 0.09
13 0.09
14 0.1
15 0.1
16 0.09
17 0.08
18 0.12
19 0.18
20 0.26
21 0.33
22 0.35
23 0.37
24 0.45
25 0.46
26 0.44
27 0.42
28 0.43
29 0.44
30 0.48
31 0.49
32 0.44
33 0.44
34 0.43
35 0.4
36 0.35
37 0.29
38 0.23
39 0.2
40 0.21
41 0.24
42 0.25
43 0.32
44 0.32
45 0.36
46 0.41
47 0.41
48 0.4
49 0.42
50 0.44
51 0.38
52 0.34
53 0.33
54 0.31
55 0.33
56 0.33
57 0.27
58 0.26
59 0.25
60 0.24
61 0.2
62 0.16
63 0.12
64 0.1
65 0.1
66 0.07
67 0.05
68 0.04
69 0.04
70 0.05
71 0.06
72 0.07
73 0.09
74 0.11
75 0.12
76 0.13
77 0.14
78 0.14
79 0.13
80 0.12
81 0.1
82 0.08
83 0.07
84 0.07
85 0.07
86 0.07
87 0.07
88 0.07
89 0.07
90 0.06
91 0.07
92 0.06
93 0.05
94 0.06
95 0.08
96 0.12
97 0.12
98 0.12
99 0.13
100 0.18
101 0.19
102 0.22
103 0.21
104 0.16
105 0.17
106 0.16
107 0.14
108 0.11
109 0.09
110 0.05
111 0.05
112 0.04
113 0.03
114 0.03
115 0.03
116 0.03
117 0.02
118 0.02
119 0.02
120 0.02
121 0.02
122 0.03
123 0.03
124 0.03
125 0.03
126 0.03
127 0.03
128 0.04
129 0.04
130 0.04
131 0.07
132 0.07
133 0.07
134 0.11
135 0.11
136 0.13
137 0.15
138 0.16
139 0.17
140 0.19
141 0.19
142 0.16
143 0.2
144 0.24
145 0.24
146 0.3
147 0.32
148 0.32
149 0.4
150 0.42
151 0.37
152 0.36
153 0.36
154 0.32
155 0.35
156 0.34
157 0.27
158 0.29
159 0.3
160 0.26
161 0.27
162 0.24
163 0.16
164 0.15
165 0.14
166 0.1
167 0.08
168 0.07
169 0.06
170 0.04
171 0.05
172 0.06
173 0.06
174 0.08
175 0.13
176 0.14
177 0.17
178 0.17
179 0.17
180 0.19
181 0.2
182 0.19
183 0.19
184 0.2
185 0.17
186 0.17
187 0.16
188 0.14
189 0.13
190 0.13
191 0.09
192 0.09
193 0.08
194 0.1
195 0.11
196 0.15
197 0.23
198 0.26
199 0.32
200 0.41
201 0.52
202 0.55
203 0.59
204 0.62
205 0.63
206 0.7
207 0.74
208 0.72
209 0.68
210 0.67
211 0.67
212 0.65
213 0.6
214 0.52
215 0.43
216 0.35
217 0.29
218 0.25
219 0.21
220 0.16
221 0.13
222 0.13
223 0.2
224 0.27
225 0.3
226 0.33
227 0.37
228 0.44
229 0.53
230 0.6
231 0.63
232 0.66
233 0.74