Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397S1W6

Protein Details
Accession A0A397S1W6    Localization Confidence High Confidence Score 17.6
NoLS Segment(s)
PositionSequenceProtein Nature
175-200VNEVKVRKKIHLRKAVRDRIRRAEKIBasic
NLS Segment(s)
PositionSequence
155-160KKIRKK
185-203KVRKKIHLRKAVRDRIRRA
Subcellular Location(s) nucl 19, cyto 6
Family & Domain DBs
Amino Acid Sequences MEHEIDLDTREEIERYVELKDSLKAFIKAXLXKQXNRTENKGENEIQNVNTVEEIEVEEEEQKXSKRKRDDNEEFSQNKRLRKESNGFKRIWEELSQPGEEIGIEMEEELDYKKGINTLTEKLLNVKNNTXRXWYEIGKIFKEEVEEIKKQEETKKIRKKEGEKIEYVARKLVYVEIMIKVNEVKVRKKIHLRKAVRDRIRRAEKIYYIFNKIGKKNEKNGIDYGIGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.15
4 0.15
5 0.16
6 0.18
7 0.21
8 0.2
9 0.22
10 0.25
11 0.25
12 0.24
13 0.28
14 0.33
15 0.38
16 0.45
17 0.5
18 0.52
19 0.6
20 0.68
21 0.69
22 0.66
23 0.64
24 0.62
25 0.6
26 0.58
27 0.51
28 0.47
29 0.42
30 0.38
31 0.35
32 0.3
33 0.23
34 0.2
35 0.17
36 0.13
37 0.11
38 0.11
39 0.08
40 0.07
41 0.07
42 0.09
43 0.09
44 0.11
45 0.12
46 0.19
47 0.25
48 0.31
49 0.38
50 0.45
51 0.52
52 0.6
53 0.69
54 0.7
55 0.7
56 0.73
57 0.67
58 0.62
59 0.64
60 0.57
61 0.51
62 0.47
63 0.45
64 0.4
65 0.46
66 0.52
67 0.54
68 0.61
69 0.62
70 0.58
71 0.55
72 0.54
73 0.48
74 0.41
75 0.33
76 0.24
77 0.23
78 0.26
79 0.24
80 0.2
81 0.18
82 0.16
83 0.14
84 0.11
85 0.06
86 0.03
87 0.03
88 0.03
89 0.03
90 0.03
91 0.03
92 0.04
93 0.04
94 0.04
95 0.04
96 0.04
97 0.06
98 0.06
99 0.08
100 0.11
101 0.13
102 0.15
103 0.16
104 0.16
105 0.18
106 0.22
107 0.23
108 0.23
109 0.26
110 0.28
111 0.34
112 0.36
113 0.35
114 0.33
115 0.32
116 0.37
117 0.36
118 0.38
119 0.32
120 0.33
121 0.3
122 0.3
123 0.28
124 0.22
125 0.22
126 0.21
127 0.22
128 0.2
129 0.22
130 0.23
131 0.24
132 0.28
133 0.33
134 0.36
135 0.45
136 0.54
137 0.59
138 0.65
139 0.72
140 0.74
141 0.75
142 0.77
143 0.73
144 0.65
145 0.62
146 0.62
147 0.57
148 0.5
149 0.44
150 0.33
151 0.27
152 0.25
153 0.23
154 0.16
155 0.13
156 0.14
157 0.13
158 0.14
159 0.13
160 0.13
161 0.13
162 0.14
163 0.17
164 0.19
165 0.22
166 0.28
167 0.34
168 0.41
169 0.51
170 0.59
171 0.66
172 0.73
173 0.75
174 0.78
175 0.83
176 0.87
177 0.86
178 0.85
179 0.83
180 0.83
181 0.85
182 0.79
183 0.74
184 0.72
185 0.68
186 0.63
187 0.65
188 0.59
189 0.55
190 0.54
191 0.53
192 0.53
193 0.51
194 0.57
195 0.58
196 0.6
197 0.63
198 0.68
199 0.69
200 0.65
201 0.63
202 0.58