Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SID7

Protein Details
Accession A0A397SID7   
Localization Confidence High
Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
24-48LLITNYIKKRKIKREEKENRKVKIEHydrophilic
NLS Segment(s)
PositionSequence
31-44KKRKIKREEKENRK
78-83IHKKRG
Subcellular Location(s) nucl 20, cyto_nucl 12, mito 5
Family & Domain DBs
Amino Acid Sequences MLTGLLRDATRLALEDGDNELKTLLITNYIKKRKIKREEKENRKVKIEYNTTDQIKNLLEYVAKDHPANIRLKSSVKIHKKRGGNISKKNLVQNDKVNRKEYVCNKCKEVEHNARTYKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.16
4 0.18
5 0.17
6 0.16
7 0.15
8 0.13
9 0.13
10 0.13
11 0.09
12 0.12
13 0.14
14 0.21
15 0.31
16 0.37
17 0.43
18 0.49
19 0.59
20 0.63
21 0.72
22 0.76
23 0.76
24 0.82
25 0.87
26 0.9
27 0.91
28 0.89
29 0.82
30 0.76
31 0.68
32 0.61
33 0.59
34 0.54
35 0.46
36 0.44
37 0.46
38 0.43
39 0.42
40 0.37
41 0.3
42 0.24
43 0.21
44 0.16
45 0.1
46 0.08
47 0.08
48 0.12
49 0.11
50 0.12
51 0.12
52 0.13
53 0.15
54 0.19
55 0.22
56 0.19
57 0.19
58 0.2
59 0.22
60 0.24
61 0.28
62 0.33
63 0.41
64 0.48
65 0.55
66 0.6
67 0.64
68 0.67
69 0.71
70 0.72
71 0.71
72 0.73
73 0.74
74 0.73
75 0.71
76 0.7
77 0.67
78 0.62
79 0.58
80 0.57
81 0.59
82 0.61
83 0.63
84 0.61
85 0.57
86 0.55
87 0.58
88 0.58
89 0.59
90 0.57
91 0.57
92 0.57
93 0.6
94 0.61
95 0.58
96 0.59
97 0.59
98 0.58
99 0.62