Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TP51

Protein Details
Accession A0A397TP51   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
91-116SGYDKGYCYHNKRYKKKVLPIISPIIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 14.333, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MDLEKDIKDLKEKQTDLEKALHYFQCMNDQRIEPVFTNQGGLPMFFPSSVSELSNDDNLKEKEEESNKVKLDNENDSSDSEEKMPDDDKYSGYDKGYCYHNKRYKKKVLPIISPIISLVII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.53
3 0.49
4 0.49
5 0.43
6 0.36
7 0.41
8 0.37
9 0.3
10 0.28
11 0.26
12 0.31
13 0.32
14 0.32
15 0.3
16 0.3
17 0.31
18 0.31
19 0.33
20 0.24
21 0.23
22 0.23
23 0.19
24 0.19
25 0.17
26 0.17
27 0.15
28 0.14
29 0.11
30 0.1
31 0.1
32 0.09
33 0.09
34 0.07
35 0.09
36 0.09
37 0.09
38 0.09
39 0.1
40 0.11
41 0.14
42 0.13
43 0.11
44 0.16
45 0.16
46 0.17
47 0.16
48 0.15
49 0.18
50 0.21
51 0.25
52 0.24
53 0.29
54 0.27
55 0.28
56 0.29
57 0.26
58 0.27
59 0.28
60 0.27
61 0.25
62 0.25
63 0.24
64 0.26
65 0.24
66 0.21
67 0.16
68 0.14
69 0.12
70 0.12
71 0.13
72 0.11
73 0.14
74 0.14
75 0.15
76 0.18
77 0.2
78 0.2
79 0.2
80 0.22
81 0.2
82 0.22
83 0.28
84 0.32
85 0.36
86 0.45
87 0.52
88 0.6
89 0.69
90 0.76
91 0.8
92 0.82
93 0.86
94 0.85
95 0.86
96 0.83
97 0.8
98 0.78
99 0.68
100 0.58
101 0.48