Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397S6Y2

Protein Details
Accession A0A397S6Y2    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
21-47CSTLQKLREHLKRKNPCKSLQKQKEVAHydrophilic
NLS Segment(s)
PositionSequence
122-138RKPRERIKTWGARLQKR
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 4
Family & Domain DBs
Amino Acid Sequences MVRKTRSDKKDTICKRCDHECSTLQKLREHLKRKNPCKSLQKQKEVAYIQVPIQKANQQAIQASKIKTQVESSSVNMSNKEKPHVVILTLIPELEPETKAPVLGVNYITEEEAKNWVSPNARKPRERIKTWGARLQKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.72
3 0.73
4 0.71
5 0.65
6 0.62
7 0.59
8 0.59
9 0.63
10 0.61
11 0.55
12 0.51
13 0.51
14 0.54
15 0.56
16 0.57
17 0.57
18 0.63
19 0.71
20 0.77
21 0.82
22 0.79
23 0.79
24 0.81
25 0.82
26 0.83
27 0.83
28 0.82
29 0.78
30 0.75
31 0.74
32 0.65
33 0.57
34 0.47
35 0.38
36 0.32
37 0.3
38 0.26
39 0.19
40 0.19
41 0.2
42 0.19
43 0.2
44 0.19
45 0.16
46 0.17
47 0.18
48 0.2
49 0.21
50 0.2
51 0.21
52 0.22
53 0.22
54 0.21
55 0.21
56 0.18
57 0.17
58 0.18
59 0.17
60 0.18
61 0.2
62 0.2
63 0.2
64 0.22
65 0.23
66 0.23
67 0.24
68 0.21
69 0.19
70 0.22
71 0.21
72 0.19
73 0.17
74 0.16
75 0.15
76 0.15
77 0.14
78 0.1
79 0.09
80 0.1
81 0.09
82 0.09
83 0.07
84 0.11
85 0.11
86 0.11
87 0.11
88 0.11
89 0.11
90 0.12
91 0.13
92 0.1
93 0.11
94 0.12
95 0.12
96 0.11
97 0.11
98 0.1
99 0.13
100 0.13
101 0.13
102 0.14
103 0.17
104 0.23
105 0.28
106 0.37
107 0.44
108 0.51
109 0.55
110 0.6
111 0.68
112 0.71
113 0.71
114 0.69
115 0.69
116 0.72
117 0.75
118 0.77