Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397TMJ6

Protein Details
Accession A0A397TMJ6    Localization Confidence Low Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
35-59SVFTVFNRETKRKQRDRSSINIEESHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, mito_nucl 13, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013216  Methyltransf_11  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0008168  F:methyltransferase activity  
GO:0032259  P:methylation  
Pfam View protein in Pfam  
PF08241  Methyltransf_11  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MFQKSSLLYRTIPYVNLISCIKKYATTANQQPKPSVFTVFNRETKRKQRDRSSINIEESRKVDYLKDEIAYRIVDRLLDIKRKFNTVVDLGSGCGHIIKHVDEDMMKKLIMCDMSSKMLERDKDINYDIDVERIVVDEELLPFEENSLEAVISNLSLHWVNDLPGAMIQIRRSLKPDGVFIASIFGGDTLFELRTSLQLAESEREGGISPRISPMTDVRDVGNLLSRAGFNLTTIDIDDITVNFPSMFELIQDLRSMGESNAVLTRRPFLKRDTMLAASAIYKELHGNPDGSIPATFQIIYLIGWKPDVTQPKPLSRGSGQVSLKKSLEGDKKGDKKDDTKGGGKSNNNNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.24
3 0.27
4 0.28
5 0.26
6 0.25
7 0.27
8 0.25
9 0.23
10 0.25
11 0.3
12 0.35
13 0.4
14 0.49
15 0.56
16 0.62
17 0.63
18 0.64
19 0.57
20 0.55
21 0.48
22 0.42
23 0.36
24 0.35
25 0.42
26 0.45
27 0.5
28 0.53
29 0.57
30 0.62
31 0.68
32 0.74
33 0.75
34 0.78
35 0.81
36 0.84
37 0.84
38 0.85
39 0.84
40 0.8
41 0.77
42 0.74
43 0.66
44 0.59
45 0.54
46 0.48
47 0.39
48 0.33
49 0.28
50 0.24
51 0.26
52 0.24
53 0.25
54 0.22
55 0.22
56 0.23
57 0.22
58 0.19
59 0.17
60 0.14
61 0.12
62 0.12
63 0.17
64 0.2
65 0.28
66 0.29
67 0.34
68 0.36
69 0.39
70 0.4
71 0.36
72 0.35
73 0.29
74 0.28
75 0.24
76 0.22
77 0.19
78 0.18
79 0.17
80 0.11
81 0.1
82 0.08
83 0.07
84 0.08
85 0.09
86 0.1
87 0.1
88 0.11
89 0.11
90 0.14
91 0.16
92 0.16
93 0.15
94 0.13
95 0.13
96 0.15
97 0.14
98 0.12
99 0.12
100 0.13
101 0.16
102 0.16
103 0.17
104 0.17
105 0.2
106 0.2
107 0.21
108 0.24
109 0.23
110 0.26
111 0.26
112 0.24
113 0.21
114 0.24
115 0.2
116 0.16
117 0.14
118 0.11
119 0.1
120 0.09
121 0.09
122 0.05
123 0.05
124 0.05
125 0.05
126 0.06
127 0.06
128 0.06
129 0.05
130 0.06
131 0.06
132 0.05
133 0.05
134 0.05
135 0.04
136 0.04
137 0.04
138 0.04
139 0.04
140 0.04
141 0.03
142 0.04
143 0.05
144 0.05
145 0.06
146 0.06
147 0.06
148 0.07
149 0.07
150 0.06
151 0.06
152 0.07
153 0.06
154 0.07
155 0.07
156 0.12
157 0.13
158 0.14
159 0.16
160 0.17
161 0.19
162 0.19
163 0.2
164 0.16
165 0.16
166 0.16
167 0.13
168 0.13
169 0.1
170 0.09
171 0.07
172 0.05
173 0.04
174 0.04
175 0.04
176 0.04
177 0.04
178 0.04
179 0.05
180 0.05
181 0.06
182 0.07
183 0.07
184 0.06
185 0.07
186 0.09
187 0.1
188 0.1
189 0.1
190 0.09
191 0.09
192 0.09
193 0.08
194 0.09
195 0.09
196 0.09
197 0.1
198 0.11
199 0.1
200 0.12
201 0.14
202 0.17
203 0.18
204 0.19
205 0.17
206 0.18
207 0.18
208 0.17
209 0.18
210 0.13
211 0.12
212 0.12
213 0.11
214 0.1
215 0.11
216 0.11
217 0.07
218 0.08
219 0.08
220 0.07
221 0.08
222 0.08
223 0.06
224 0.07
225 0.07
226 0.06
227 0.07
228 0.07
229 0.07
230 0.06
231 0.06
232 0.06
233 0.06
234 0.06
235 0.05
236 0.08
237 0.08
238 0.09
239 0.1
240 0.09
241 0.09
242 0.1
243 0.1
244 0.08
245 0.1
246 0.09
247 0.1
248 0.14
249 0.15
250 0.15
251 0.14
252 0.19
253 0.21
254 0.25
255 0.26
256 0.26
257 0.36
258 0.37
259 0.41
260 0.42
261 0.39
262 0.36
263 0.34
264 0.3
265 0.22
266 0.2
267 0.17
268 0.11
269 0.1
270 0.11
271 0.13
272 0.15
273 0.15
274 0.16
275 0.15
276 0.17
277 0.17
278 0.16
279 0.14
280 0.12
281 0.12
282 0.12
283 0.11
284 0.08
285 0.09
286 0.08
287 0.08
288 0.11
289 0.12
290 0.11
291 0.12
292 0.12
293 0.13
294 0.19
295 0.28
296 0.27
297 0.36
298 0.41
299 0.49
300 0.54
301 0.52
302 0.53
303 0.46
304 0.5
305 0.45
306 0.49
307 0.45
308 0.47
309 0.5
310 0.49
311 0.47
312 0.41
313 0.39
314 0.39
315 0.43
316 0.42
317 0.45
318 0.5
319 0.58
320 0.62
321 0.68
322 0.65
323 0.62
324 0.65
325 0.68
326 0.65
327 0.63
328 0.63
329 0.64
330 0.66
331 0.67