Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SUN4

Protein Details
Accession A0A397SUN4   
Localization Confidence High
Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-37MQHKDYTDKKRNEREIKRSERKAKRNERDARNREEIPBasic
45-64IWKNRECITKKKPRLDRLYDHydrophilic
NLS Segment(s)
PositionSequence
9-30KKRNEREIKRSERKAKRNERDA
Subcellular Location(s) nucl 24.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR013083  Znf_RING/FYVE/PHD  
CDD cd16448  RING-H2  
Amino Acid Sequences MQHKDYTDKKRNEREIKRSERKAKRNERDARNREEIPLNNNQPEIWKNRECITKKKPRLDRLYDWVMCTLLSEVPGSILSCGHSYHAECFIQVNQKCPYCYEYLCDGIKYHYKVFQNTLSKAFDNSIGEDSEDLENQENLQDNNVDEIVFIDKDINKKLEEALGLFRLCELRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.88
3 0.9
4 0.9
5 0.9
6 0.91
7 0.9
8 0.9
9 0.91
10 0.91
11 0.9
12 0.9
13 0.9
14 0.9
15 0.91
16 0.88
17 0.85
18 0.81
19 0.72
20 0.65
21 0.61
22 0.53
23 0.47
24 0.5
25 0.46
26 0.4
27 0.39
28 0.35
29 0.31
30 0.32
31 0.32
32 0.3
33 0.29
34 0.29
35 0.34
36 0.43
37 0.44
38 0.5
39 0.54
40 0.58
41 0.64
42 0.72
43 0.75
44 0.76
45 0.82
46 0.8
47 0.76
48 0.72
49 0.72
50 0.63
51 0.55
52 0.47
53 0.37
54 0.29
55 0.23
56 0.16
57 0.08
58 0.07
59 0.06
60 0.05
61 0.06
62 0.06
63 0.06
64 0.05
65 0.05
66 0.05
67 0.06
68 0.06
69 0.07
70 0.07
71 0.08
72 0.09
73 0.12
74 0.11
75 0.1
76 0.11
77 0.12
78 0.19
79 0.19
80 0.22
81 0.22
82 0.24
83 0.25
84 0.25
85 0.26
86 0.21
87 0.21
88 0.2
89 0.19
90 0.22
91 0.22
92 0.21
93 0.19
94 0.19
95 0.24
96 0.23
97 0.21
98 0.23
99 0.25
100 0.26
101 0.29
102 0.35
103 0.35
104 0.35
105 0.38
106 0.35
107 0.33
108 0.32
109 0.29
110 0.24
111 0.19
112 0.19
113 0.17
114 0.14
115 0.14
116 0.13
117 0.14
118 0.12
119 0.11
120 0.11
121 0.1
122 0.1
123 0.1
124 0.12
125 0.12
126 0.11
127 0.12
128 0.12
129 0.11
130 0.13
131 0.13
132 0.11
133 0.09
134 0.1
135 0.11
136 0.1
137 0.1
138 0.11
139 0.14
140 0.17
141 0.22
142 0.23
143 0.21
144 0.22
145 0.24
146 0.24
147 0.23
148 0.22
149 0.22
150 0.24
151 0.24
152 0.23
153 0.22