Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397SL16

Protein Details
Accession A0A397SL16    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
50-70EYKEIRKKNADKARENRKKVEBasic
NLS Segment(s)
PositionSequence
55-68RKKNADKARENRKK
Subcellular Location(s) nucl 20, cyto_nucl 13.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF08583  Cmc1  
Amino Acid Sequences MHPNLAYHKHPKCLDVILRLEECHKSGLFNKYFGACNEIKRELNDCLTLEYKEIRKKNADKARENRKKVEELWKEFRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.42
3 0.41
4 0.37
5 0.37
6 0.36
7 0.36
8 0.3
9 0.26
10 0.21
11 0.17
12 0.15
13 0.19
14 0.27
15 0.26
16 0.26
17 0.26
18 0.26
19 0.27
20 0.25
21 0.26
22 0.18
23 0.19
24 0.22
25 0.24
26 0.23
27 0.22
28 0.25
29 0.22
30 0.22
31 0.21
32 0.17
33 0.17
34 0.17
35 0.17
36 0.15
37 0.17
38 0.2
39 0.26
40 0.29
41 0.3
42 0.37
43 0.42
44 0.52
45 0.58
46 0.61
47 0.64
48 0.71
49 0.78
50 0.8
51 0.81
52 0.79
53 0.76
54 0.72
55 0.68
56 0.7
57 0.68
58 0.67