Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397T0Y3

Protein Details
Accession A0A397T0Y3    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
87-116EGHWAKDCRSSRRERRRSRSPRRRFVFVKVBasic
NLS Segment(s)
PositionSequence
97-110SRRERRRSRSPRRR
Subcellular Location(s) nucl 11, cyto 9, pero 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003723  F:RNA binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00076  RRM_1  
PF00098  zf-CCHC  
PROSITE View protein in PROSITE  
PS50102  RRM  
PS50158  ZF_CCHC  
Amino Acid Sequences MALFIGRLSLDTHPRDLEHIFDKYGRLNRLEVKRGYAFVEYQDERDASDAMKETDGLRVRGNRIVVEWAKNGGRKPAENQCFKCGREGHWAKDCRSSRRERRRSRSPRRRFVFVKVVLC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.28
3 0.26
4 0.26
5 0.24
6 0.23
7 0.22
8 0.22
9 0.23
10 0.26
11 0.31
12 0.3
13 0.27
14 0.28
15 0.35
16 0.41
17 0.47
18 0.42
19 0.41
20 0.4
21 0.39
22 0.38
23 0.31
24 0.24
25 0.19
26 0.25
27 0.2
28 0.19
29 0.2
30 0.18
31 0.16
32 0.17
33 0.15
34 0.08
35 0.09
36 0.09
37 0.08
38 0.08
39 0.09
40 0.08
41 0.13
42 0.15
43 0.14
44 0.15
45 0.17
46 0.18
47 0.2
48 0.2
49 0.15
50 0.14
51 0.18
52 0.18
53 0.18
54 0.17
55 0.17
56 0.18
57 0.2
58 0.2
59 0.21
60 0.22
61 0.21
62 0.25
63 0.33
64 0.39
65 0.45
66 0.47
67 0.49
68 0.51
69 0.51
70 0.52
71 0.44
72 0.4
73 0.43
74 0.45
75 0.44
76 0.48
77 0.52
78 0.48
79 0.56
80 0.58
81 0.54
82 0.57
83 0.61
84 0.64
85 0.71
86 0.8
87 0.81
88 0.85
89 0.89
90 0.93
91 0.94
92 0.94
93 0.93
94 0.93
95 0.89
96 0.89
97 0.82
98 0.79
99 0.78