Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TDD9

Protein Details
Accession A0A397TDD9   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
89-115HKILYPTYKYQPKRKRNNYSTFRSYEPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
Amino Acid Sequences MPTAKDLLRDQKSSIKVKRPPNLNIIYTNRLNKFGLLEIIRKFCEQHGINKQKLIPLSKKVSKILWNELLSDQHRKFFEKLALEVSKEHKILYPTYKYQPKRKRNNYSTFRSYEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.58
3 0.6
4 0.67
5 0.72
6 0.72
7 0.69
8 0.69
9 0.67
10 0.6
11 0.6
12 0.56
13 0.54
14 0.51
15 0.52
16 0.45
17 0.41
18 0.39
19 0.32
20 0.28
21 0.23
22 0.23
23 0.19
24 0.21
25 0.21
26 0.23
27 0.23
28 0.22
29 0.22
30 0.17
31 0.24
32 0.21
33 0.27
34 0.36
35 0.41
36 0.42
37 0.44
38 0.44
39 0.38
40 0.39
41 0.35
42 0.28
43 0.28
44 0.34
45 0.36
46 0.38
47 0.37
48 0.37
49 0.39
50 0.39
51 0.38
52 0.39
53 0.35
54 0.34
55 0.33
56 0.34
57 0.3
58 0.34
59 0.29
60 0.26
61 0.27
62 0.28
63 0.29
64 0.28
65 0.32
66 0.27
67 0.28
68 0.3
69 0.3
70 0.28
71 0.29
72 0.29
73 0.29
74 0.26
75 0.25
76 0.21
77 0.22
78 0.26
79 0.31
80 0.34
81 0.34
82 0.43
83 0.52
84 0.56
85 0.65
86 0.71
87 0.74
88 0.79
89 0.85
90 0.88
91 0.89
92 0.92
93 0.91
94 0.89
95 0.87