Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397T8A3

Protein Details
Accession A0A397T8A3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
36-60PRLLFFKCRAREKKNKRKFFFHYCYHydrophilic
NLS Segment(s)
PositionSequence
49-49K
Subcellular Location(s) mito 8, plas 8, E.R. 5, golg 4, mito_nucl 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MHVKRSFFIISNLLSSIFTMLLRLIILVDKSVIFLPRLLFFKCRAREKKNKRKFFFHYCYHLIIVIINCDFFGYLNCS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.13
4 0.1
5 0.08
6 0.07
7 0.07
8 0.06
9 0.06
10 0.06
11 0.05
12 0.05
13 0.06
14 0.05
15 0.06
16 0.05
17 0.06
18 0.07
19 0.08
20 0.07
21 0.08
22 0.09
23 0.11
24 0.13
25 0.14
26 0.14
27 0.17
28 0.24
29 0.29
30 0.38
31 0.43
32 0.5
33 0.6
34 0.7
35 0.78
36 0.81
37 0.86
38 0.82
39 0.83
40 0.82
41 0.82
42 0.79
43 0.74
44 0.71
45 0.64
46 0.61
47 0.53
48 0.45
49 0.35
50 0.29
51 0.23
52 0.18
53 0.15
54 0.12
55 0.11
56 0.11
57 0.11
58 0.08