Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397S6T8

Protein Details
Accession A0A397S6T8    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
60-81GQPSALCKKKPRHKELDGLVQAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 16, nucl 14.5, cyto 10.5
Family & Domain DBs
Amino Acid Sequences GNLSDAMVRALLAKAPTCDQQDRADEIIDLGEELGGKKKEQLIKVARTYRQLERNTPKAGQPSALCKKKPRHKELDGLVQAQDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.2
4 0.24
5 0.26
6 0.26
7 0.3
8 0.32
9 0.34
10 0.33
11 0.29
12 0.23
13 0.21
14 0.18
15 0.13
16 0.09
17 0.05
18 0.04
19 0.04
20 0.04
21 0.08
22 0.09
23 0.09
24 0.1
25 0.15
26 0.19
27 0.2
28 0.28
29 0.3
30 0.34
31 0.41
32 0.45
33 0.43
34 0.44
35 0.47
36 0.45
37 0.47
38 0.45
39 0.47
40 0.49
41 0.53
42 0.52
43 0.49
44 0.47
45 0.44
46 0.41
47 0.36
48 0.31
49 0.34
50 0.41
51 0.46
52 0.46
53 0.5
54 0.59
55 0.66
56 0.75
57 0.74
58 0.74
59 0.74
60 0.8
61 0.8
62 0.8
63 0.75
64 0.66