Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397T7D8

Protein Details
Accession A0A397T7D8    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
69-91TIEKLARRDKKNWKELWKKEKSYHydrophilic
NLS Segment(s)
PositionSequence
76-83RDKKNWKE
86-86K
Subcellular Location(s) nucl 24, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MSDIYKDLERIKALYEKEKYEKNRKRYQIDPSCLECYKVKEGTEPEWFKKFWRIFQKVILKAMDYNRNTIEKLARRDKKNWKELWKKEKSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.36
3 0.38
4 0.42
5 0.49
6 0.53
7 0.59
8 0.65
9 0.66
10 0.72
11 0.74
12 0.75
13 0.73
14 0.76
15 0.75
16 0.72
17 0.68
18 0.63
19 0.59
20 0.53
21 0.49
22 0.4
23 0.34
24 0.32
25 0.29
26 0.25
27 0.23
28 0.25
29 0.27
30 0.34
31 0.33
32 0.31
33 0.31
34 0.31
35 0.29
36 0.35
37 0.33
38 0.31
39 0.39
40 0.41
41 0.41
42 0.49
43 0.57
44 0.51
45 0.53
46 0.46
47 0.37
48 0.35
49 0.38
50 0.38
51 0.3
52 0.31
53 0.3
54 0.31
55 0.31
56 0.3
57 0.33
58 0.31
59 0.39
60 0.47
61 0.53
62 0.56
63 0.66
64 0.74
65 0.76
66 0.79
67 0.8
68 0.8
69 0.82
70 0.87
71 0.89