Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397T810

Protein Details
Accession A0A397T810    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
43-65NKQERYKIKKVLKNKNKKTKDELBasic
NLS Segment(s)
PositionSequence
48-60YKIKKVLKNKNKK
Subcellular Location(s) nucl 20.5, cyto_nucl 14.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MDQNKDIKEEMKKLIEGITSGVKEKIWKERYDKINKISKYIDNKQERYKIKKVLKNKNKKTKDELTDPIEVEEKLIRLSKNNIAKNNKKLMSTLIANRYIDSLIIQQEKVNKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.32
3 0.26
4 0.22
5 0.21
6 0.18
7 0.19
8 0.19
9 0.17
10 0.19
11 0.22
12 0.3
13 0.3
14 0.34
15 0.38
16 0.47
17 0.56
18 0.63
19 0.66
20 0.63
21 0.67
22 0.62
23 0.61
24 0.56
25 0.52
26 0.51
27 0.52
28 0.55
29 0.54
30 0.57
31 0.59
32 0.64
33 0.63
34 0.62
35 0.61
36 0.61
37 0.61
38 0.64
39 0.67
40 0.7
41 0.74
42 0.78
43 0.82
44 0.83
45 0.82
46 0.81
47 0.78
48 0.76
49 0.71
50 0.67
51 0.62
52 0.56
53 0.51
54 0.46
55 0.4
56 0.32
57 0.26
58 0.2
59 0.16
60 0.11
61 0.1
62 0.12
63 0.12
64 0.13
65 0.18
66 0.24
67 0.32
68 0.37
69 0.44
70 0.51
71 0.58
72 0.64
73 0.69
74 0.64
75 0.57
76 0.52
77 0.48
78 0.44
79 0.41
80 0.4
81 0.37
82 0.39
83 0.39
84 0.38
85 0.35
86 0.3
87 0.25
88 0.19
89 0.16
90 0.17
91 0.19
92 0.19
93 0.2