Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TQH2

Protein Details
Accession A0A397TQH2   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
240-259QESRNKRSSRLSNCHNIRKLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR003108  GAR_dom  
Gene Ontology GO:0008017  F:microtubule binding  
PROSITE View protein in PROSITE  
PS51460  GAR  
Amino Acid Sequences MDLSPASEFVLLSTEETNYDKLIKDIFEPIDKMFPEEAHEFLINFFSEKLNEDQWEEKINSLMEANSRQDKFITKLKRFMLEMLPILGNKTIKASAYRKTVMNQKGNADRADGIAYTSNKQNSYEISVTEGSRPYVTESNKETSDFLQNARAAKDMINFAVTQEVLHKRALPSCFRTFIVQVFEFNLRFYFMDYLAQYCIFKIETCEIPTDWKETLQFTSFYRSIVTWALLVGEADKKFQESRNKRSSRLSNCHNIRKLLKLSHNKAREGTKKDMMITI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.14
4 0.15
5 0.14
6 0.15
7 0.15
8 0.15
9 0.17
10 0.16
11 0.16
12 0.21
13 0.23
14 0.24
15 0.26
16 0.26
17 0.29
18 0.28
19 0.3
20 0.25
21 0.22
22 0.24
23 0.24
24 0.23
25 0.2
26 0.21
27 0.18
28 0.17
29 0.19
30 0.14
31 0.12
32 0.12
33 0.1
34 0.1
35 0.13
36 0.16
37 0.16
38 0.17
39 0.2
40 0.22
41 0.22
42 0.27
43 0.24
44 0.22
45 0.21
46 0.2
47 0.18
48 0.16
49 0.15
50 0.13
51 0.16
52 0.19
53 0.24
54 0.24
55 0.24
56 0.24
57 0.27
58 0.28
59 0.33
60 0.39
61 0.36
62 0.43
63 0.45
64 0.48
65 0.45
66 0.45
67 0.41
68 0.34
69 0.31
70 0.26
71 0.24
72 0.2
73 0.2
74 0.18
75 0.14
76 0.11
77 0.12
78 0.1
79 0.11
80 0.17
81 0.19
82 0.23
83 0.29
84 0.31
85 0.3
86 0.33
87 0.41
88 0.43
89 0.46
90 0.43
91 0.42
92 0.46
93 0.47
94 0.44
95 0.36
96 0.29
97 0.23
98 0.21
99 0.16
100 0.11
101 0.12
102 0.13
103 0.13
104 0.15
105 0.16
106 0.16
107 0.17
108 0.17
109 0.15
110 0.19
111 0.18
112 0.15
113 0.16
114 0.17
115 0.17
116 0.17
117 0.17
118 0.12
119 0.11
120 0.11
121 0.11
122 0.15
123 0.15
124 0.18
125 0.2
126 0.23
127 0.23
128 0.23
129 0.21
130 0.18
131 0.22
132 0.19
133 0.16
134 0.18
135 0.19
136 0.2
137 0.19
138 0.18
139 0.14
140 0.14
141 0.16
142 0.12
143 0.1
144 0.1
145 0.1
146 0.09
147 0.1
148 0.09
149 0.07
150 0.11
151 0.13
152 0.14
153 0.14
154 0.16
155 0.15
156 0.2
157 0.23
158 0.23
159 0.27
160 0.29
161 0.31
162 0.3
163 0.31
164 0.28
165 0.27
166 0.28
167 0.22
168 0.2
169 0.19
170 0.21
171 0.19
172 0.18
173 0.16
174 0.12
175 0.11
176 0.12
177 0.11
178 0.09
179 0.12
180 0.12
181 0.13
182 0.13
183 0.14
184 0.12
185 0.11
186 0.12
187 0.09
188 0.09
189 0.1
190 0.13
191 0.15
192 0.17
193 0.19
194 0.18
195 0.23
196 0.24
197 0.24
198 0.21
199 0.19
200 0.19
201 0.19
202 0.22
203 0.19
204 0.2
205 0.18
206 0.25
207 0.23
208 0.22
209 0.22
210 0.19
211 0.19
212 0.19
213 0.19
214 0.11
215 0.11
216 0.11
217 0.1
218 0.09
219 0.09
220 0.12
221 0.12
222 0.13
223 0.13
224 0.15
225 0.17
226 0.24
227 0.34
228 0.38
229 0.48
230 0.57
231 0.62
232 0.64
233 0.71
234 0.75
235 0.74
236 0.75
237 0.73
238 0.73
239 0.77
240 0.83
241 0.78
242 0.76
243 0.68
244 0.67
245 0.66
246 0.64
247 0.65
248 0.66
249 0.69
250 0.72
251 0.74
252 0.69
253 0.68
254 0.69
255 0.68
256 0.64
257 0.64
258 0.61
259 0.59