Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SM94

Protein Details
Accession A0A397SM94    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
58-86KSILLRKRTSIKGKRYNNPTPNYHKRNKNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 7, plas 4, extr 4, E.R. 4, nucl 3, pero 3
Family & Domain DBs
Amino Acid Sequences MARLSWIMLLVFVVLLVNFVSNSPVESATKKRRNINARENVLLMVARNIPTEFSGTNKSILLRKRTSIKGKRYNNPTPNYHKRNKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.04
3 0.04
4 0.04
5 0.04
6 0.04
7 0.06
8 0.05
9 0.06
10 0.07
11 0.09
12 0.1
13 0.13
14 0.21
15 0.31
16 0.38
17 0.43
18 0.49
19 0.56
20 0.63
21 0.69
22 0.72
23 0.71
24 0.66
25 0.63
26 0.56
27 0.47
28 0.39
29 0.3
30 0.19
31 0.11
32 0.08
33 0.07
34 0.07
35 0.07
36 0.07
37 0.08
38 0.09
39 0.08
40 0.1
41 0.14
42 0.14
43 0.16
44 0.16
45 0.17
46 0.2
47 0.26
48 0.3
49 0.29
50 0.33
51 0.39
52 0.47
53 0.56
54 0.61
55 0.66
56 0.69
57 0.76
58 0.81
59 0.82
60 0.85
61 0.83
62 0.81
63 0.78
64 0.78
65 0.8
66 0.8