Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397S4G9

Protein Details
Accession A0A397S4G9    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
71-102ICKEEAQKLMNKKRRKKENLKIFGRKRLNKCGHydrophilic
NLS Segment(s)
PositionSequence
83-100NKKRRKKENLKIFGRKRL
Subcellular Location(s) nucl 16.5, mito_nucl 13.5, mito 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013757  Topo_IIA_A_a_sf  
Gene Ontology GO:0005524  F:ATP binding  
GO:0003677  F:DNA binding  
GO:0003918  F:DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity  
Amino Acid Sequences MIKILEVRRFRNKARFIQIKINRELEFESLSRSNIIKLLEKKKFADDKDXNXDEDFNNDHGYNYLMKSPSWSICKEEAQKLMNKKRRKKENLKIFGRKRLNKCG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.74
3 0.68
4 0.73
5 0.75
6 0.72
7 0.69
8 0.65
9 0.55
10 0.48
11 0.45
12 0.36
13 0.3
14 0.23
15 0.22
16 0.18
17 0.18
18 0.18
19 0.17
20 0.15
21 0.15
22 0.17
23 0.18
24 0.25
25 0.34
26 0.37
27 0.39
28 0.4
29 0.45
30 0.48
31 0.44
32 0.47
33 0.4
34 0.43
35 0.47
36 0.47
37 0.4
38 0.35
39 0.34
40 0.25
41 0.24
42 0.17
43 0.1
44 0.1
45 0.09
46 0.1
47 0.11
48 0.1
49 0.11
50 0.11
51 0.11
52 0.14
53 0.16
54 0.19
55 0.21
56 0.22
57 0.23
58 0.26
59 0.33
60 0.35
61 0.37
62 0.38
63 0.38
64 0.43
65 0.49
66 0.56
67 0.58
68 0.63
69 0.68
70 0.74
71 0.81
72 0.86
73 0.88
74 0.88
75 0.91
76 0.92
77 0.92
78 0.93
79 0.89
80 0.89
81 0.88
82 0.87