Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397T0B7

Protein Details
Accession A0A397T0B7   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
70-100AYPNYVYRPNKNKGKNEKRRQARKSAVATFSHydrophilic
NLS Segment(s)
PositionSequence
80-93KNKGKNEKRRQARK
Subcellular Location(s) nucl 18.5, cyto_nucl 10, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01389  HMG-box_ROX1-like  
Amino Acid Sequences MQPEKRPPRPPNAFILYRRAKQPAILAAHRNLTNAEISRYISNCWRNETDEERLAWERYADQKKLEHMQAYPNYVYRPNKNKGKNEKRRQARKSAVATFSSQDTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.66
3 0.62
4 0.56
5 0.56
6 0.51
7 0.44
8 0.39
9 0.41
10 0.38
11 0.37
12 0.37
13 0.37
14 0.35
15 0.39
16 0.37
17 0.33
18 0.26
19 0.21
20 0.2
21 0.17
22 0.16
23 0.13
24 0.14
25 0.16
26 0.16
27 0.16
28 0.2
29 0.25
30 0.24
31 0.27
32 0.27
33 0.28
34 0.31
35 0.34
36 0.32
37 0.28
38 0.27
39 0.25
40 0.25
41 0.23
42 0.2
43 0.16
44 0.13
45 0.19
46 0.24
47 0.23
48 0.23
49 0.25
50 0.28
51 0.32
52 0.33
53 0.26
54 0.22
55 0.29
56 0.3
57 0.32
58 0.29
59 0.26
60 0.26
61 0.3
62 0.34
63 0.34
64 0.4
65 0.45
66 0.53
67 0.6
68 0.69
69 0.74
70 0.81
71 0.84
72 0.87
73 0.89
74 0.9
75 0.93
76 0.9
77 0.89
78 0.87
79 0.85
80 0.83
81 0.8
82 0.74
83 0.66
84 0.61
85 0.52