Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397SH68

Protein Details
Accession A0A397SH68    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
25-46ATSSNAKTKIKKPPRPPNAFILHydrophilic
NLS Segment(s)
PositionSequence
31-40KTKIKKPPRP
Subcellular Location(s) nucl 14, mito 10, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01389  HMG-box_ROX1-like  
Amino Acid Sequences MLPDTDVRLPSFALPCGVAGPPPKATSSNAKTKIKKPPRPPNAFILYRRAKQPGIVARHQGITNNEVSKEIGRMWHEEPAEVRQKFQKMADAAKQEHMKKYPEYRYRPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.15
4 0.15
5 0.14
6 0.14
7 0.16
8 0.18
9 0.18
10 0.2
11 0.2
12 0.22
13 0.3
14 0.33
15 0.4
16 0.46
17 0.53
18 0.57
19 0.62
20 0.7
21 0.71
22 0.75
23 0.76
24 0.78
25 0.81
26 0.84
27 0.81
28 0.77
29 0.74
30 0.69
31 0.6
32 0.58
33 0.52
34 0.46
35 0.45
36 0.4
37 0.32
38 0.29
39 0.33
40 0.31
41 0.31
42 0.31
43 0.31
44 0.29
45 0.31
46 0.3
47 0.26
48 0.21
49 0.17
50 0.18
51 0.17
52 0.16
53 0.15
54 0.16
55 0.14
56 0.13
57 0.12
58 0.12
59 0.13
60 0.16
61 0.17
62 0.21
63 0.21
64 0.21
65 0.22
66 0.25
67 0.32
68 0.29
69 0.3
70 0.31
71 0.33
72 0.35
73 0.35
74 0.35
75 0.29
76 0.35
77 0.41
78 0.42
79 0.41
80 0.46
81 0.52
82 0.48
83 0.52
84 0.5
85 0.47
86 0.47
87 0.55
88 0.58
89 0.61