Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TK49

Protein Details
Accession A0A397TK49   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-49MVNPVKKVKIVKKRIKPFKRHQSDRYKSVKEAWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
6-55KKVKIVKKRIKPFKRHQSDRYKSVKEAWRKPKGIDNRVRRRFKGQLPMPK
Subcellular Location(s) mito_nucl 13.333, nucl 13, mito 12.5, cyto_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVNPVKKVKIVKKRIKPFKRHQSDRYKSVKEAWRKPKGIDNRVRRRFKGQLPMPKIGYGSNKKTRHLMPNGFKKFLVSNIRELELLLMHNKTYAAEIAHNVSLRNRIAIIERAQQLNVRVTNAKARVRTQEVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.91
3 0.92
4 0.92
5 0.92
6 0.93
7 0.91
8 0.9
9 0.9
10 0.88
11 0.87
12 0.85
13 0.78
14 0.69
15 0.68
16 0.67
17 0.65
18 0.67
19 0.68
20 0.69
21 0.66
22 0.67
23 0.67
24 0.69
25 0.69
26 0.68
27 0.69
28 0.7
29 0.78
30 0.82
31 0.76
32 0.73
33 0.7
34 0.67
35 0.67
36 0.63
37 0.63
38 0.63
39 0.65
40 0.59
41 0.52
42 0.45
43 0.37
44 0.37
45 0.33
46 0.34
47 0.4
48 0.41
49 0.41
50 0.45
51 0.46
52 0.46
53 0.48
54 0.48
55 0.47
56 0.55
57 0.58
58 0.55
59 0.51
60 0.44
61 0.38
62 0.36
63 0.35
64 0.26
65 0.28
66 0.28
67 0.29
68 0.28
69 0.27
70 0.21
71 0.14
72 0.13
73 0.1
74 0.09
75 0.08
76 0.08
77 0.08
78 0.08
79 0.08
80 0.08
81 0.08
82 0.09
83 0.1
84 0.12
85 0.14
86 0.14
87 0.14
88 0.15
89 0.18
90 0.17
91 0.17
92 0.15
93 0.14
94 0.17
95 0.21
96 0.24
97 0.26
98 0.29
99 0.29
100 0.3
101 0.31
102 0.31
103 0.32
104 0.3
105 0.26
106 0.25
107 0.26
108 0.34
109 0.39
110 0.41
111 0.4
112 0.43
113 0.47