Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TCX7

Protein Details
Accession A0A397TCX7    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
13-44KFGKDKLKSSISKRKKKKVKRIDKAISRIFRRBasic
NLS Segment(s)
PositionSequence
16-49KDKLKSSISKRKKKKVKRIDKAISRIFRRIKNLR
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences EVGETLLACRQIKFGKDKLKSSISKRKKKKVKRIDKAISRIFRRIKNLRNELHKKTVNYLAKNYDVVIIPKFNKDQFKNCAEYVNIVILFILTMAEIQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.43
3 0.49
4 0.52
5 0.55
6 0.59
7 0.61
8 0.64
9 0.67
10 0.67
11 0.72
12 0.78
13 0.82
14 0.84
15 0.89
16 0.91
17 0.91
18 0.92
19 0.92
20 0.93
21 0.92
22 0.9
23 0.87
24 0.84
25 0.8
26 0.72
27 0.69
28 0.63
29 0.57
30 0.56
31 0.56
32 0.55
33 0.57
34 0.61
35 0.59
36 0.63
37 0.66
38 0.63
39 0.63
40 0.6
41 0.51
42 0.47
43 0.51
44 0.47
45 0.42
46 0.41
47 0.36
48 0.34
49 0.33
50 0.3
51 0.23
52 0.18
53 0.17
54 0.16
55 0.16
56 0.16
57 0.19
58 0.21
59 0.23
60 0.3
61 0.33
62 0.39
63 0.42
64 0.46
65 0.48
66 0.46
67 0.46
68 0.38
69 0.36
70 0.31
71 0.29
72 0.23
73 0.19
74 0.18
75 0.14
76 0.13
77 0.1
78 0.08
79 0.03