Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397S289

Protein Details
Accession A0A397S289    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
162-182YIILAKKSRKEKESKGEKKPIBasic
NLS Segment(s)
PositionSequence
167-182KKSRKEKESKGEKKPI
Subcellular Location(s) nucl 14.5, cyto_nucl 12.833, cyto 10, cyto_pero 6.333
Family & Domain DBs
Amino Acid Sequences MKHILKGQILNEYALDYDKTFIEQSDKIYKKLIPELKKLMSGHYNPSLKYLLRDVLNPAAEKIQYAKKQRERIYDDDTYFTYSKLPENTPKWAYDAKKIRNEAMDVKMLEYGVNNNNDKMTQYDNVSLTDLNLDYLLNSAEMNLIQLKDLDEISESLQLIIYIILAKKSRKEKESKGEKKPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.11
4 0.11
5 0.11
6 0.12
7 0.12
8 0.12
9 0.16
10 0.16
11 0.21
12 0.3
13 0.32
14 0.31
15 0.34
16 0.35
17 0.34
18 0.42
19 0.45
20 0.41
21 0.46
22 0.52
23 0.51
24 0.55
25 0.51
26 0.46
27 0.45
28 0.41
29 0.4
30 0.41
31 0.41
32 0.35
33 0.38
34 0.36
35 0.29
36 0.29
37 0.26
38 0.22
39 0.2
40 0.21
41 0.21
42 0.23
43 0.25
44 0.23
45 0.21
46 0.18
47 0.17
48 0.17
49 0.17
50 0.19
51 0.24
52 0.3
53 0.39
54 0.45
55 0.54
56 0.58
57 0.64
58 0.63
59 0.62
60 0.62
61 0.58
62 0.52
63 0.45
64 0.4
65 0.35
66 0.29
67 0.23
68 0.18
69 0.13
70 0.14
71 0.15
72 0.17
73 0.2
74 0.22
75 0.28
76 0.28
77 0.28
78 0.28
79 0.31
80 0.3
81 0.32
82 0.38
83 0.39
84 0.44
85 0.45
86 0.44
87 0.41
88 0.41
89 0.37
90 0.31
91 0.28
92 0.22
93 0.21
94 0.2
95 0.18
96 0.16
97 0.12
98 0.12
99 0.12
100 0.16
101 0.16
102 0.16
103 0.17
104 0.17
105 0.17
106 0.16
107 0.15
108 0.13
109 0.15
110 0.18
111 0.19
112 0.19
113 0.2
114 0.18
115 0.14
116 0.14
117 0.12
118 0.08
119 0.08
120 0.07
121 0.06
122 0.06
123 0.06
124 0.05
125 0.05
126 0.05
127 0.05
128 0.05
129 0.06
130 0.07
131 0.07
132 0.07
133 0.08
134 0.09
135 0.1
136 0.1
137 0.09
138 0.09
139 0.09
140 0.11
141 0.13
142 0.12
143 0.11
144 0.11
145 0.1
146 0.09
147 0.09
148 0.07
149 0.07
150 0.08
151 0.11
152 0.15
153 0.18
154 0.25
155 0.35
156 0.43
157 0.48
158 0.57
159 0.63
160 0.71
161 0.8
162 0.82