Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397T503

Protein Details
Accession A0A397T503    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
78-102GQNYQNQRQNRQQNQNDQNQRQNNQHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 13, mito 3, plas 3, E.R. 3, pero 2, golg 2, mito_nucl 2
Family & Domain DBs
Amino Acid Sequences MKSILFMFGFLALVALTTAWQNSNNRNNNNRNNRNIYNPFYNPNVPNRGHQNFNPYMNPYVHNHPQPPNNQPQQRPQGQNYQNQRQNRQQNQNDQNQRQNNQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.04
4 0.04
5 0.05
6 0.06
7 0.1
8 0.13
9 0.21
10 0.31
11 0.39
12 0.45
13 0.53
14 0.62
15 0.68
16 0.77
17 0.76
18 0.73
19 0.73
20 0.69
21 0.69
22 0.65
23 0.59
24 0.54
25 0.49
26 0.44
27 0.4
28 0.42
29 0.35
30 0.34
31 0.35
32 0.3
33 0.31
34 0.36
35 0.35
36 0.34
37 0.33
38 0.36
39 0.33
40 0.34
41 0.33
42 0.27
43 0.27
44 0.25
45 0.26
46 0.21
47 0.25
48 0.27
49 0.29
50 0.31
51 0.33
52 0.38
53 0.4
54 0.43
55 0.47
56 0.51
57 0.54
58 0.54
59 0.59
60 0.62
61 0.66
62 0.66
63 0.6
64 0.61
65 0.6
66 0.66
67 0.66
68 0.67
69 0.66
70 0.67
71 0.7
72 0.69
73 0.74
74 0.76
75 0.77
76 0.75
77 0.8
78 0.82
79 0.86
80 0.86
81 0.83
82 0.82