Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SVU5

Protein Details
Accession A0A397SVU5   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
14-37LIRLEAEIKRKKRNRRISLFFAITHydrophilic
NLS Segment(s)
PositionSequence
22-29KRKKRNRR
Subcellular Location(s) nucl 10, mito 5, plas 4, E.R. 3, golg 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSTPDKYESLTINLIRLEAEIKRKKRNRRISLFFAITILIITTVFIIYSSDDELTRQISLVLASVVNLILTFERFLSLKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.17
4 0.15
5 0.13
6 0.23
7 0.29
8 0.35
9 0.45
10 0.53
11 0.63
12 0.72
13 0.8
14 0.8
15 0.82
16 0.84
17 0.82
18 0.81
19 0.72
20 0.61
21 0.5
22 0.4
23 0.29
24 0.21
25 0.13
26 0.06
27 0.04
28 0.03
29 0.03
30 0.03
31 0.03
32 0.03
33 0.03
34 0.04
35 0.05
36 0.05
37 0.06
38 0.06
39 0.07
40 0.08
41 0.09
42 0.08
43 0.08
44 0.07
45 0.07
46 0.07
47 0.07
48 0.07
49 0.05
50 0.06
51 0.06
52 0.06
53 0.05
54 0.05
55 0.05
56 0.05
57 0.06
58 0.07
59 0.07
60 0.09