Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A2QGF6

Protein Details
Accession A2QGF6    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
357-381KDREIWKKLYDDFRRKRRDVCKLLSBasic
NLS Segment(s)
Subcellular Location(s) plas 8, nucl 7, mito 3, cyto 3, golg 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR029044  Nucleotide-diphossugar_trans  
Gene Ontology GO:0016757  F:glycosyltransferase activity  
GO:0048856  P:anatomical structure development  
GO:0043934  P:sporulation  
KEGG ang:ANI_1_1226034  -  
Amino Acid Sequences MAGKKGPVLPYRRGSDASEADFFDIPDEPCWSIIKRQLRYLKSPRAWLAIFVFVLFILSQRREKPPSPALPHIDYDRVDWSLYAYSQYATSSPYLCNALIVFDTLQRLGSRAQRVLFYPEDWDVLVDDDRDRDSQLLAMAREKYNVMLVPIDVQMVKAGSGPSESWDKSISKLLAFGETEFERVIHIDSDVSVLQNMDELFFLPPSQVAMPRAYWELPDIKQLSSLLIVLQPSYKEWYALMDKAQAISYGQVDSNVSSRVRYDMELMNERYADSALVLPHRQYGLVTGEFRKDDHRAFLGNEHEEWDPEKVLAEAKLVHFSDWPLPKPWVMWPQELLADMLPKCKVKPGTMHESGCKDREIWKKLYDDFRRKRRDVCKLLSYPAPNWPPRQKPQGPLEAAPEGIPISPAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.5
3 0.49
4 0.45
5 0.4
6 0.36
7 0.35
8 0.33
9 0.29
10 0.23
11 0.2
12 0.17
13 0.16
14 0.18
15 0.16
16 0.17
17 0.2
18 0.2
19 0.23
20 0.31
21 0.38
22 0.39
23 0.48
24 0.56
25 0.59
26 0.67
27 0.71
28 0.74
29 0.69
30 0.73
31 0.67
32 0.65
33 0.59
34 0.52
35 0.45
36 0.38
37 0.33
38 0.25
39 0.22
40 0.15
41 0.16
42 0.12
43 0.1
44 0.11
45 0.14
46 0.19
47 0.23
48 0.3
49 0.36
50 0.38
51 0.45
52 0.5
53 0.57
54 0.6
55 0.63
56 0.62
57 0.6
58 0.6
59 0.55
60 0.49
61 0.4
62 0.35
63 0.3
64 0.25
65 0.21
66 0.18
67 0.17
68 0.15
69 0.15
70 0.14
71 0.12
72 0.11
73 0.11
74 0.12
75 0.11
76 0.11
77 0.12
78 0.12
79 0.12
80 0.14
81 0.15
82 0.14
83 0.15
84 0.13
85 0.12
86 0.11
87 0.12
88 0.1
89 0.09
90 0.11
91 0.1
92 0.11
93 0.1
94 0.11
95 0.13
96 0.19
97 0.22
98 0.24
99 0.26
100 0.26
101 0.28
102 0.31
103 0.3
104 0.24
105 0.22
106 0.2
107 0.19
108 0.17
109 0.16
110 0.11
111 0.11
112 0.11
113 0.09
114 0.08
115 0.09
116 0.1
117 0.11
118 0.11
119 0.1
120 0.09
121 0.1
122 0.12
123 0.13
124 0.12
125 0.15
126 0.18
127 0.18
128 0.18
129 0.18
130 0.16
131 0.15
132 0.14
133 0.12
134 0.09
135 0.09
136 0.1
137 0.09
138 0.1
139 0.08
140 0.08
141 0.07
142 0.07
143 0.07
144 0.06
145 0.06
146 0.05
147 0.07
148 0.07
149 0.08
150 0.12
151 0.12
152 0.12
153 0.15
154 0.15
155 0.16
156 0.2
157 0.19
158 0.15
159 0.17
160 0.16
161 0.16
162 0.16
163 0.14
164 0.13
165 0.12
166 0.13
167 0.11
168 0.1
169 0.08
170 0.08
171 0.09
172 0.06
173 0.06
174 0.05
175 0.05
176 0.07
177 0.07
178 0.06
179 0.06
180 0.05
181 0.05
182 0.06
183 0.06
184 0.05
185 0.05
186 0.05
187 0.06
188 0.06
189 0.06
190 0.05
191 0.05
192 0.05
193 0.06
194 0.07
195 0.08
196 0.09
197 0.09
198 0.11
199 0.12
200 0.11
201 0.11
202 0.11
203 0.13
204 0.12
205 0.17
206 0.17
207 0.16
208 0.17
209 0.17
210 0.15
211 0.12
212 0.12
213 0.07
214 0.07
215 0.07
216 0.06
217 0.07
218 0.07
219 0.07
220 0.1
221 0.1
222 0.09
223 0.09
224 0.12
225 0.14
226 0.15
227 0.15
228 0.15
229 0.15
230 0.15
231 0.15
232 0.12
233 0.1
234 0.1
235 0.1
236 0.08
237 0.07
238 0.07
239 0.08
240 0.08
241 0.09
242 0.11
243 0.1
244 0.09
245 0.1
246 0.12
247 0.13
248 0.13
249 0.15
250 0.15
251 0.2
252 0.25
253 0.26
254 0.25
255 0.24
256 0.23
257 0.21
258 0.17
259 0.13
260 0.07
261 0.08
262 0.08
263 0.1
264 0.11
265 0.11
266 0.13
267 0.13
268 0.12
269 0.11
270 0.12
271 0.14
272 0.16
273 0.18
274 0.18
275 0.21
276 0.21
277 0.22
278 0.23
279 0.22
280 0.21
281 0.23
282 0.23
283 0.22
284 0.23
285 0.27
286 0.28
287 0.27
288 0.25
289 0.24
290 0.22
291 0.21
292 0.21
293 0.18
294 0.14
295 0.12
296 0.12
297 0.1
298 0.11
299 0.11
300 0.11
301 0.12
302 0.13
303 0.18
304 0.18
305 0.18
306 0.17
307 0.19
308 0.25
309 0.27
310 0.29
311 0.26
312 0.28
313 0.28
314 0.28
315 0.33
316 0.35
317 0.34
318 0.35
319 0.33
320 0.33
321 0.34
322 0.33
323 0.27
324 0.19
325 0.2
326 0.17
327 0.19
328 0.19
329 0.19
330 0.19
331 0.25
332 0.28
333 0.28
334 0.37
335 0.41
336 0.48
337 0.54
338 0.58
339 0.56
340 0.59
341 0.59
342 0.51
343 0.45
344 0.37
345 0.38
346 0.44
347 0.46
348 0.44
349 0.46
350 0.49
351 0.55
352 0.64
353 0.66
354 0.67
355 0.71
356 0.77
357 0.81
358 0.79
359 0.82
360 0.82
361 0.82
362 0.81
363 0.79
364 0.79
365 0.73
366 0.74
367 0.72
368 0.66
369 0.57
370 0.57
371 0.57
372 0.51
373 0.55
374 0.6
375 0.62
376 0.66
377 0.74
378 0.72
379 0.72
380 0.76
381 0.78
382 0.73
383 0.67
384 0.64
385 0.56
386 0.49
387 0.4
388 0.32
389 0.23
390 0.18