Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SVS0

Protein Details
Accession A0A397SVS0    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
17-40RSSVSTSHGRKKRKHNARSVAASDHydrophilic
NLS Segment(s)
PositionSequence
26-31RKKRKH
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MSGSDIDTTVTRSSITRSSVSTSHGRKKRKHNARSVAASDNNRPTPTIAGRANQNEMNKPDLLNPDEMNKPDLLNPDETNKPDLLNLDETNKLDLLNSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.21
3 0.2
4 0.21
5 0.24
6 0.25
7 0.28
8 0.33
9 0.36
10 0.43
11 0.48
12 0.55
13 0.59
14 0.69
15 0.76
16 0.78
17 0.8
18 0.81
19 0.83
20 0.83
21 0.81
22 0.74
23 0.68
24 0.63
25 0.56
26 0.5
27 0.45
28 0.39
29 0.33
30 0.29
31 0.24
32 0.22
33 0.21
34 0.22
35 0.18
36 0.18
37 0.22
38 0.23
39 0.24
40 0.24
41 0.24
42 0.23
43 0.23
44 0.24
45 0.21
46 0.19
47 0.2
48 0.21
49 0.21
50 0.2
51 0.19
52 0.2
53 0.22
54 0.23
55 0.21
56 0.18
57 0.17
58 0.17
59 0.21
60 0.19
61 0.21
62 0.21
63 0.24
64 0.28
65 0.29
66 0.29
67 0.25
68 0.24
69 0.21
70 0.22
71 0.21
72 0.22
73 0.22
74 0.22
75 0.25
76 0.26
77 0.27
78 0.25
79 0.21