Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A5AAG4

Protein Details
Accession A5AAG4    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MKTTPNERRRKRITKRSRVAWSKLLHydrophilic
NLS Segment(s)
PositionSequence
8-17RRRKRITKRS
Subcellular Location(s) mito 17.5, mito_nucl 14, nucl 9.5
Family & Domain DBs
Amino Acid Sequences MKTTPNERRRKRITKRSRVAWSKLLFDCLCPMTQHKFRQCSNQTAYYRNSRNKELDLRYEWDKISLRKEGREWNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.92
3 0.91
4 0.91
5 0.87
6 0.82
7 0.79
8 0.7
9 0.65
10 0.56
11 0.52
12 0.41
13 0.34
14 0.31
15 0.24
16 0.22
17 0.16
18 0.18
19 0.19
20 0.26
21 0.32
22 0.36
23 0.4
24 0.4
25 0.5
26 0.5
27 0.51
28 0.49
29 0.51
30 0.47
31 0.46
32 0.48
33 0.47
34 0.51
35 0.51
36 0.5
37 0.47
38 0.48
39 0.49
40 0.54
41 0.5
42 0.49
43 0.46
44 0.46
45 0.45
46 0.45
47 0.4
48 0.36
49 0.37
50 0.34
51 0.35
52 0.39
53 0.39
54 0.42
55 0.47