Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TK32

Protein Details
Accession A0A397TK32    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
60-87FDEAKKREEERKANKKKPKLNWGFETKHBasic
NLS Segment(s)
PositionSequence
63-79AKKREEERKANKKKPKL
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR037690  FAM204A  
IPR001943  UVR_dom  
Pfam View protein in Pfam  
PF02151  UVR  
Amino Acid Sequences MNEHLKDVNHGRLSAKSKLEKELDKAVENGDLELASKLSDQIAQNNYEIMVSEAIERKEFDEAKKREEERKANKKKPKLNWGFETKHRWETKSNM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.44
3 0.43
4 0.43
5 0.48
6 0.51
7 0.48
8 0.47
9 0.49
10 0.45
11 0.4
12 0.38
13 0.32
14 0.29
15 0.26
16 0.22
17 0.13
18 0.1
19 0.09
20 0.09
21 0.08
22 0.05
23 0.05
24 0.05
25 0.05
26 0.09
27 0.08
28 0.13
29 0.15
30 0.16
31 0.16
32 0.16
33 0.16
34 0.12
35 0.12
36 0.08
37 0.06
38 0.05
39 0.06
40 0.09
41 0.09
42 0.1
43 0.1
44 0.1
45 0.14
46 0.15
47 0.18
48 0.25
49 0.27
50 0.31
51 0.38
52 0.41
53 0.44
54 0.52
55 0.58
56 0.59
57 0.69
58 0.75
59 0.77
60 0.84
61 0.86
62 0.87
63 0.86
64 0.87
65 0.86
66 0.84
67 0.82
68 0.82
69 0.79
70 0.77
71 0.76
72 0.7
73 0.69
74 0.65
75 0.59