Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A2QCQ3

Protein Details
Accession A2QCQ3    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
61-80HSSPKKRRKVNHACVYCRRSHydrophilic
NLS Segment(s)
PositionSequence
66-67KR
Subcellular Location(s) nucl 20.5, cyto_nucl 12, cyto 2.5, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences MTEKTAASTGPGPDQQTSNGTADRTKPDVTEEEQTGADASAKDNSQNTPSLKADGAAAGAHSSPKKRRKVNHACVYCRRSHMTCDSGATLHAMHKTEYWPPLPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.24
4 0.25
5 0.23
6 0.22
7 0.2
8 0.21
9 0.23
10 0.26
11 0.27
12 0.24
13 0.22
14 0.23
15 0.26
16 0.26
17 0.28
18 0.24
19 0.22
20 0.21
21 0.21
22 0.18
23 0.15
24 0.13
25 0.08
26 0.08
27 0.08
28 0.08
29 0.09
30 0.1
31 0.11
32 0.12
33 0.16
34 0.16
35 0.18
36 0.19
37 0.19
38 0.18
39 0.17
40 0.15
41 0.11
42 0.11
43 0.06
44 0.06
45 0.05
46 0.05
47 0.06
48 0.07
49 0.11
50 0.19
51 0.28
52 0.36
53 0.43
54 0.51
55 0.6
56 0.71
57 0.78
58 0.8
59 0.8
60 0.79
61 0.81
62 0.79
63 0.71
64 0.64
65 0.58
66 0.5
67 0.47
68 0.46
69 0.4
70 0.36
71 0.36
72 0.33
73 0.28
74 0.26
75 0.22
76 0.17
77 0.16
78 0.18
79 0.16
80 0.15
81 0.17
82 0.19
83 0.24
84 0.28