Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2L669

Protein Details
Accession E2L669   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
96-115ADAQKVKKRRDDPSKPIQRVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5cyto_nucl 17.5, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013961  RAI1  
Gene Ontology GO:0004518  F:nuclease activity  
GO:0000166  F:nucleotide binding  
KEGG mpr:MPER_01300  -  
Pfam View protein in Pfam  
PF08652  RAI1  
Amino Acid Sequences IPNERWHMQSYLLGVPEIFVGYRSKNLRIVRTQMIQVSDIQTPNLEDKISRGHSVLLALRAELEKEKGEGSIGDDTIWRVVIRNGSWKQLQRLDDADAQKVKKRRDDPSKPIQRVGVVPEVMLQHIKEDSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.15
4 0.13
5 0.09
6 0.07
7 0.08
8 0.1
9 0.16
10 0.19
11 0.22
12 0.28
13 0.32
14 0.38
15 0.41
16 0.45
17 0.44
18 0.45
19 0.44
20 0.4
21 0.37
22 0.32
23 0.28
24 0.25
25 0.21
26 0.19
27 0.16
28 0.14
29 0.13
30 0.14
31 0.13
32 0.11
33 0.08
34 0.09
35 0.15
36 0.17
37 0.17
38 0.16
39 0.15
40 0.16
41 0.18
42 0.18
43 0.13
44 0.11
45 0.1
46 0.1
47 0.1
48 0.1
49 0.08
50 0.08
51 0.06
52 0.07
53 0.07
54 0.07
55 0.07
56 0.07
57 0.08
58 0.09
59 0.08
60 0.08
61 0.08
62 0.08
63 0.08
64 0.09
65 0.06
66 0.05
67 0.07
68 0.1
69 0.1
70 0.19
71 0.2
72 0.24
73 0.28
74 0.31
75 0.34
76 0.37
77 0.38
78 0.32
79 0.33
80 0.33
81 0.35
82 0.33
83 0.33
84 0.32
85 0.32
86 0.35
87 0.39
88 0.4
89 0.43
90 0.48
91 0.53
92 0.6
93 0.69
94 0.72
95 0.77
96 0.83
97 0.77
98 0.74
99 0.66
100 0.58
101 0.5
102 0.46
103 0.42
104 0.31
105 0.28
106 0.27
107 0.25
108 0.24
109 0.23
110 0.18
111 0.13