Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395MUF2

Protein Details
Accession A0A395MUF2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
54-73GSKGGRTKRRTGNHMRSTRVBasic
NLS Segment(s)
Subcellular Location(s) plas 11, extr 6, vacu 5, mito 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGGVLSCIKSCLQTIGDAIMAVIGGIGRILQAIISAVVRFCGIIVSFLTCGYCGSKGGRTKRRTGNHMRSTRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.14
4 0.13
5 0.12
6 0.08
7 0.07
8 0.05
9 0.04
10 0.02
11 0.02
12 0.02
13 0.02
14 0.02
15 0.02
16 0.02
17 0.02
18 0.02
19 0.02
20 0.03
21 0.03
22 0.04
23 0.03
24 0.04
25 0.04
26 0.04
27 0.04
28 0.04
29 0.04
30 0.05
31 0.05
32 0.06
33 0.07
34 0.07
35 0.07
36 0.07
37 0.07
38 0.08
39 0.08
40 0.09
41 0.11
42 0.17
43 0.25
44 0.35
45 0.44
46 0.48
47 0.56
48 0.65
49 0.71
50 0.74
51 0.78
52 0.78
53 0.8