Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395N522

Protein Details
Accession A0A395N522    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
16-45PYDQWPISRRRAKNKRIKKLKNQLEKSKAEHydrophilic
NLS Segment(s)
PositionSequence
24-37RRRAKNKRIKKLKN
Subcellular Location(s) nucl 18.5, cyto_nucl 10.5, mito 6
Family & Domain DBs
Amino Acid Sequences MPKTTTARCRCLRYEPYDQWPISRRRAKNKRIKKLKNQLEKSKAEVLYWKREYKLSCREVYSLKKHVKRLLDDFEDRGELQQEMTLLRLQMMNLGM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.64
3 0.65
4 0.66
5 0.62
6 0.57
7 0.56
8 0.55
9 0.55
10 0.58
11 0.56
12 0.6
13 0.7
14 0.76
15 0.79
16 0.84
17 0.86
18 0.88
19 0.91
20 0.91
21 0.91
22 0.91
23 0.91
24 0.88
25 0.87
26 0.83
27 0.76
28 0.69
29 0.65
30 0.55
31 0.44
32 0.42
33 0.36
34 0.37
35 0.39
36 0.36
37 0.3
38 0.33
39 0.34
40 0.35
41 0.41
42 0.37
43 0.36
44 0.36
45 0.37
46 0.4
47 0.46
48 0.45
49 0.44
50 0.48
51 0.51
52 0.54
53 0.57
54 0.58
55 0.56
56 0.56
57 0.55
58 0.53
59 0.5
60 0.46
61 0.43
62 0.39
63 0.33
64 0.27
65 0.21
66 0.15
67 0.13
68 0.12
69 0.11
70 0.1
71 0.11
72 0.12
73 0.1
74 0.11
75 0.12
76 0.1