Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395MT20

Protein Details
Accession A0A395MT20    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
216-241ASGGYSGRSWRRRRSVRSSNGYEGRRHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 23, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009571  SUR7/Rim9-like_fungi  
Gene Ontology GO:0005886  C:plasma membrane  
Pfam View protein in Pfam  
PF06687  SUR7  
Amino Acid Sequences MAKNAPLGLAGLILMAVSLLFLWFIVLSGLTSTTPFDKTYFLRADTSGISGARDTTQWNFFYICGAGNNNCDGARAAPVIGRAWDSNPSNAPSSLVGGRAGDTTSNRQFFLWRFGWVFILITLFFETIAFFTGFIACCGRLGAGISGFMSMFALFCSSVAMSLMTATWVLARNAFRSSGRSASIGRYAFGFAWASWATLFIATILFCLGMRGDKSASGGYSGRSWRRRRSVRSSNGYEGRRVKDDYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.03
4 0.02
5 0.02
6 0.02
7 0.02
8 0.03
9 0.03
10 0.03
11 0.04
12 0.04
13 0.04
14 0.04
15 0.05
16 0.06
17 0.06
18 0.07
19 0.08
20 0.1
21 0.12
22 0.13
23 0.13
24 0.16
25 0.18
26 0.25
27 0.27
28 0.27
29 0.27
30 0.27
31 0.28
32 0.25
33 0.25
34 0.19
35 0.16
36 0.15
37 0.13
38 0.13
39 0.12
40 0.11
41 0.12
42 0.13
43 0.18
44 0.18
45 0.19
46 0.19
47 0.18
48 0.19
49 0.17
50 0.14
51 0.11
52 0.13
53 0.13
54 0.14
55 0.15
56 0.14
57 0.13
58 0.13
59 0.12
60 0.11
61 0.11
62 0.1
63 0.09
64 0.09
65 0.11
66 0.1
67 0.1
68 0.11
69 0.1
70 0.1
71 0.16
72 0.16
73 0.17
74 0.18
75 0.2
76 0.2
77 0.2
78 0.2
79 0.15
80 0.16
81 0.14
82 0.13
83 0.11
84 0.09
85 0.1
86 0.09
87 0.09
88 0.08
89 0.08
90 0.13
91 0.18
92 0.19
93 0.19
94 0.18
95 0.2
96 0.2
97 0.26
98 0.21
99 0.18
100 0.18
101 0.18
102 0.19
103 0.17
104 0.16
105 0.09
106 0.09
107 0.07
108 0.06
109 0.06
110 0.05
111 0.05
112 0.05
113 0.05
114 0.04
115 0.05
116 0.05
117 0.05
118 0.05
119 0.06
120 0.06
121 0.07
122 0.07
123 0.06
124 0.06
125 0.06
126 0.06
127 0.05
128 0.06
129 0.06
130 0.05
131 0.05
132 0.05
133 0.06
134 0.05
135 0.05
136 0.05
137 0.04
138 0.04
139 0.03
140 0.04
141 0.04
142 0.04
143 0.05
144 0.04
145 0.05
146 0.05
147 0.05
148 0.04
149 0.05
150 0.05
151 0.04
152 0.04
153 0.04
154 0.05
155 0.07
156 0.07
157 0.11
158 0.12
159 0.13
160 0.14
161 0.16
162 0.16
163 0.18
164 0.21
165 0.2
166 0.21
167 0.21
168 0.21
169 0.22
170 0.28
171 0.25
172 0.21
173 0.19
174 0.19
175 0.17
176 0.18
177 0.16
178 0.09
179 0.13
180 0.13
181 0.13
182 0.11
183 0.12
184 0.11
185 0.1
186 0.1
187 0.06
188 0.06
189 0.06
190 0.06
191 0.05
192 0.05
193 0.05
194 0.06
195 0.06
196 0.08
197 0.09
198 0.11
199 0.12
200 0.13
201 0.15
202 0.16
203 0.16
204 0.16
205 0.16
206 0.15
207 0.2
208 0.27
209 0.34
210 0.41
211 0.48
212 0.55
213 0.65
214 0.73
215 0.77
216 0.81
217 0.83
218 0.85
219 0.88
220 0.85
221 0.84
222 0.83
223 0.76
224 0.73
225 0.69
226 0.64
227 0.59