Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395M534

Protein Details
Accession A0A395M534   
Localization Confidence Medium
Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
68-93ATATPKSGSEKRKRKSNKDASDRAASHydrophilic
300-335MHAISVKRQRKLKMKKKKYKKLMKRTRVLRRKLDRTBasic
NLS Segment(s)
PositionSequence
76-85SEKRKRKSNK
305-334VKRQRKLKMKKKKYKKLMKRTRVLRRKLDR
Subcellular Location(s) mito 18, nucl 8.5, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MLPSSVRRIVASAASSTPQTGVVSSIASATVKTTPIFIQNQQRRYSSSKPSKSDNGSNEISAGQSVPATATPKSGSEKRKRKSNKDASDRAASMKKLPSVPSTHHMSQEGSALGLSSFFSLHRPISVTQTMPRAVSDEHFASIFAARTRNNKMADTESTLSSTIEQLEGPMAQMTIGGQEGQEVMHKVDIKNPDGTESSMYLQIDTMSGEFLPFRPPPLPQAQAAGESESAIAEAEAVEDVPQHRVYKALFTIEESTDPDGQIRIMAHSPRIMQDQPRSFLERLALRQLKFDEAQGRRDMHAISVKRQRKLKMKKKKYKKLMKRTRVLRRKLDRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.2
4 0.18
5 0.16
6 0.14
7 0.12
8 0.12
9 0.11
10 0.11
11 0.1
12 0.1
13 0.1
14 0.09
15 0.09
16 0.09
17 0.11
18 0.12
19 0.12
20 0.13
21 0.14
22 0.2
23 0.24
24 0.29
25 0.38
26 0.44
27 0.51
28 0.53
29 0.54
30 0.52
31 0.55
32 0.56
33 0.56
34 0.59
35 0.62
36 0.61
37 0.66
38 0.7
39 0.7
40 0.7
41 0.64
42 0.6
43 0.53
44 0.49
45 0.43
46 0.35
47 0.28
48 0.2
49 0.15
50 0.09
51 0.07
52 0.07
53 0.06
54 0.08
55 0.1
56 0.1
57 0.12
58 0.12
59 0.15
60 0.21
61 0.28
62 0.36
63 0.44
64 0.54
65 0.59
66 0.69
67 0.76
68 0.8
69 0.84
70 0.86
71 0.85
72 0.85
73 0.86
74 0.81
75 0.78
76 0.69
77 0.62
78 0.55
79 0.45
80 0.4
81 0.35
82 0.34
83 0.3
84 0.31
85 0.3
86 0.3
87 0.33
88 0.33
89 0.37
90 0.35
91 0.34
92 0.34
93 0.3
94 0.28
95 0.26
96 0.21
97 0.14
98 0.12
99 0.09
100 0.08
101 0.07
102 0.06
103 0.04
104 0.05
105 0.05
106 0.06
107 0.08
108 0.08
109 0.09
110 0.11
111 0.12
112 0.17
113 0.18
114 0.19
115 0.2
116 0.23
117 0.23
118 0.21
119 0.2
120 0.17
121 0.15
122 0.15
123 0.15
124 0.12
125 0.12
126 0.12
127 0.12
128 0.1
129 0.11
130 0.11
131 0.09
132 0.1
133 0.11
134 0.16
135 0.2
136 0.25
137 0.26
138 0.26
139 0.27
140 0.28
141 0.28
142 0.29
143 0.26
144 0.21
145 0.2
146 0.19
147 0.17
148 0.14
149 0.12
150 0.08
151 0.07
152 0.06
153 0.05
154 0.05
155 0.05
156 0.05
157 0.05
158 0.04
159 0.03
160 0.04
161 0.03
162 0.03
163 0.04
164 0.03
165 0.03
166 0.03
167 0.04
168 0.04
169 0.05
170 0.05
171 0.06
172 0.08
173 0.1
174 0.1
175 0.14
176 0.18
177 0.19
178 0.21
179 0.21
180 0.21
181 0.2
182 0.21
183 0.18
184 0.15
185 0.15
186 0.14
187 0.14
188 0.12
189 0.11
190 0.1
191 0.09
192 0.08
193 0.07
194 0.05
195 0.05
196 0.05
197 0.05
198 0.05
199 0.09
200 0.09
201 0.11
202 0.12
203 0.13
204 0.17
205 0.23
206 0.25
207 0.21
208 0.25
209 0.23
210 0.24
211 0.24
212 0.21
213 0.15
214 0.13
215 0.12
216 0.08
217 0.08
218 0.05
219 0.05
220 0.03
221 0.03
222 0.03
223 0.03
224 0.03
225 0.03
226 0.04
227 0.05
228 0.08
229 0.1
230 0.11
231 0.11
232 0.13
233 0.14
234 0.17
235 0.19
236 0.19
237 0.18
238 0.2
239 0.23
240 0.22
241 0.22
242 0.19
243 0.21
244 0.19
245 0.18
246 0.16
247 0.13
248 0.12
249 0.13
250 0.11
251 0.11
252 0.14
253 0.16
254 0.17
255 0.19
256 0.2
257 0.21
258 0.25
259 0.25
260 0.28
261 0.36
262 0.4
263 0.42
264 0.44
265 0.47
266 0.43
267 0.42
268 0.41
269 0.37
270 0.34
271 0.41
272 0.43
273 0.37
274 0.42
275 0.41
276 0.4
277 0.36
278 0.37
279 0.36
280 0.34
281 0.39
282 0.39
283 0.4
284 0.36
285 0.38
286 0.34
287 0.29
288 0.34
289 0.32
290 0.36
291 0.44
292 0.49
293 0.54
294 0.6
295 0.64
296 0.66
297 0.75
298 0.77
299 0.78
300 0.83
301 0.87
302 0.93
303 0.95
304 0.95
305 0.96
306 0.96
307 0.96
308 0.96
309 0.96
310 0.94
311 0.94
312 0.94
313 0.93
314 0.91
315 0.91