Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395MAA7

Protein Details
Accession A0A395MAA7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
79-99LPVPKDDKVRCHRYKNQYCFQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18.5, cyto_mito 13.5, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MVAAIASTVSASPAKKPAPVAKLAPDNTLAVVVVSAMNGWGYEQSTTPVRVPFGKLTHFDKLFISSLEVRGVMVVGDGLPVPKDDKVRCHRYKNQYCFQLGSLEFKKGNPALISTGSVEFGWVLCRVEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.28
4 0.34
5 0.36
6 0.4
7 0.41
8 0.41
9 0.48
10 0.47
11 0.43
12 0.37
13 0.32
14 0.28
15 0.25
16 0.18
17 0.1
18 0.08
19 0.06
20 0.05
21 0.04
22 0.04
23 0.03
24 0.03
25 0.03
26 0.03
27 0.04
28 0.04
29 0.05
30 0.06
31 0.08
32 0.1
33 0.12
34 0.13
35 0.13
36 0.14
37 0.15
38 0.17
39 0.19
40 0.2
41 0.21
42 0.22
43 0.25
44 0.3
45 0.29
46 0.27
47 0.23
48 0.24
49 0.21
50 0.18
51 0.16
52 0.11
53 0.12
54 0.11
55 0.11
56 0.08
57 0.07
58 0.07
59 0.05
60 0.04
61 0.03
62 0.02
63 0.03
64 0.03
65 0.03
66 0.03
67 0.04
68 0.05
69 0.07
70 0.12
71 0.14
72 0.23
73 0.31
74 0.42
75 0.49
76 0.57
77 0.64
78 0.71
79 0.8
80 0.8
81 0.8
82 0.76
83 0.71
84 0.64
85 0.55
86 0.5
87 0.4
88 0.39
89 0.33
90 0.3
91 0.29
92 0.27
93 0.32
94 0.26
95 0.29
96 0.22
97 0.23
98 0.22
99 0.23
100 0.25
101 0.2
102 0.2
103 0.18
104 0.17
105 0.15
106 0.12
107 0.1
108 0.11
109 0.1