Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395N3Z0

Protein Details
Accession A0A395N3Z0    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
315-336APSQPRSSRPVKQERRSPIPERHydrophilic
351-379PPPAARPPPAVNPRKRKGTDIFMKPKRRAHydrophilic
NLS Segment(s)
PositionSequence
290-332SKPAAKAKRGLLSNSYKGPKPQAAAAPSQPRSSRPVKQERRSP
351-379PPPAARPPPAVNPRKRKGTDIFMKPKRRA
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR010684  RNA_pol_II_trans_fac_SIII_A  
Gene Ontology GO:0070449  C:elongin complex  
GO:0006368  P:transcription elongation by RNA polymerase II  
Pfam View protein in Pfam  
PF06881  Elongin_A  
Amino Acid Sequences MPAKSLLEIATTACIKNIRELDSVGDYLLYKTIRPLLLKIDNPKQLRTIEINSPQIQGETGEIWLKIIKHEFPMEFKQKAYKPPNATKWYRVYEKYKSDHQKALDESEAKLKSAFMGIKKDREKTITKIVDDRRLLPQGGRVGPKKPWGFGARDPNGSTLAFTRGSRTKTNNGASVMRKVRRETKEIASIHGSLSRPTQSSNAISKIRKAPPAMVNDYQRASQPAVRPPPPKPTPSEVVEAHEERAQYITDSDSDDGGGDDLFDDDPSPPRQAPVRPSSSTLKGLSPSPSKPAAKAKRGLLSNSYKGPKPQAAAAPSQPRSSRPVKQERRSPIPEREVLSPSPEAGPSSSPPPAARPPPAVNPRKRKGTDIFMKPKRRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.26
4 0.3
5 0.3
6 0.3
7 0.31
8 0.33
9 0.33
10 0.32
11 0.25
12 0.21
13 0.17
14 0.16
15 0.19
16 0.15
17 0.12
18 0.14
19 0.19
20 0.22
21 0.23
22 0.25
23 0.29
24 0.37
25 0.42
26 0.47
27 0.5
28 0.55
29 0.56
30 0.56
31 0.52
32 0.46
33 0.45
34 0.43
35 0.39
36 0.39
37 0.44
38 0.48
39 0.45
40 0.46
41 0.41
42 0.36
43 0.31
44 0.23
45 0.17
46 0.12
47 0.11
48 0.12
49 0.11
50 0.11
51 0.13
52 0.13
53 0.14
54 0.17
55 0.17
56 0.19
57 0.24
58 0.25
59 0.28
60 0.37
61 0.41
62 0.39
63 0.38
64 0.43
65 0.43
66 0.51
67 0.53
68 0.53
69 0.55
70 0.63
71 0.72
72 0.72
73 0.72
74 0.69
75 0.7
76 0.68
77 0.65
78 0.62
79 0.59
80 0.59
81 0.63
82 0.61
83 0.62
84 0.65
85 0.64
86 0.63
87 0.59
88 0.57
89 0.51
90 0.5
91 0.45
92 0.37
93 0.32
94 0.35
95 0.33
96 0.27
97 0.25
98 0.2
99 0.16
100 0.19
101 0.21
102 0.16
103 0.25
104 0.28
105 0.36
106 0.4
107 0.43
108 0.41
109 0.43
110 0.44
111 0.4
112 0.47
113 0.44
114 0.41
115 0.46
116 0.49
117 0.52
118 0.49
119 0.47
120 0.41
121 0.39
122 0.38
123 0.3
124 0.3
125 0.27
126 0.3
127 0.32
128 0.29
129 0.29
130 0.31
131 0.39
132 0.36
133 0.31
134 0.32
135 0.31
136 0.33
137 0.37
138 0.45
139 0.4
140 0.41
141 0.41
142 0.37
143 0.35
144 0.3
145 0.24
146 0.15
147 0.14
148 0.13
149 0.12
150 0.15
151 0.18
152 0.22
153 0.25
154 0.28
155 0.31
156 0.37
157 0.4
158 0.39
159 0.37
160 0.38
161 0.36
162 0.39
163 0.4
164 0.37
165 0.36
166 0.35
167 0.42
168 0.41
169 0.44
170 0.41
171 0.39
172 0.44
173 0.42
174 0.42
175 0.35
176 0.31
177 0.27
178 0.26
179 0.22
180 0.14
181 0.15
182 0.15
183 0.13
184 0.13
185 0.14
186 0.13
187 0.17
188 0.19
189 0.22
190 0.25
191 0.26
192 0.29
193 0.35
194 0.37
195 0.37
196 0.35
197 0.36
198 0.36
199 0.42
200 0.43
201 0.4
202 0.39
203 0.37
204 0.37
205 0.32
206 0.27
207 0.23
208 0.19
209 0.19
210 0.2
211 0.25
212 0.31
213 0.36
214 0.39
215 0.4
216 0.49
217 0.49
218 0.47
219 0.45
220 0.44
221 0.43
222 0.42
223 0.45
224 0.35
225 0.35
226 0.36
227 0.32
228 0.28
229 0.24
230 0.21
231 0.17
232 0.17
233 0.13
234 0.09
235 0.09
236 0.09
237 0.08
238 0.1
239 0.1
240 0.09
241 0.09
242 0.09
243 0.08
244 0.07
245 0.06
246 0.04
247 0.04
248 0.05
249 0.05
250 0.04
251 0.05
252 0.06
253 0.09
254 0.12
255 0.14
256 0.14
257 0.16
258 0.2
259 0.24
260 0.31
261 0.35
262 0.4
263 0.39
264 0.43
265 0.47
266 0.47
267 0.47
268 0.41
269 0.35
270 0.3
271 0.31
272 0.32
273 0.32
274 0.29
275 0.29
276 0.35
277 0.34
278 0.37
279 0.45
280 0.48
281 0.51
282 0.56
283 0.56
284 0.56
285 0.58
286 0.57
287 0.54
288 0.52
289 0.49
290 0.51
291 0.49
292 0.44
293 0.44
294 0.47
295 0.43
296 0.38
297 0.39
298 0.38
299 0.38
300 0.4
301 0.45
302 0.48
303 0.46
304 0.49
305 0.45
306 0.41
307 0.44
308 0.46
309 0.47
310 0.48
311 0.57
312 0.63
313 0.7
314 0.77
315 0.8
316 0.83
317 0.83
318 0.8
319 0.78
320 0.75
321 0.72
322 0.65
323 0.61
324 0.56
325 0.49
326 0.46
327 0.37
328 0.3
329 0.27
330 0.24
331 0.21
332 0.18
333 0.2
334 0.18
335 0.22
336 0.23
337 0.23
338 0.23
339 0.28
340 0.35
341 0.38
342 0.41
343 0.44
344 0.47
345 0.55
346 0.64
347 0.69
348 0.71
349 0.75
350 0.78
351 0.82
352 0.79
353 0.76
354 0.73
355 0.74
356 0.74
357 0.74
358 0.77
359 0.76