Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A2R3P0

Protein Details
Accession A2R3P0    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
321-350CIVATVPPTDRCRRRKRTLRKPSLSLNARYHydrophilic
NLS Segment(s)
PositionSequence
335-336RK
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038886  E3_SLX5/Rfp1  
Amino Acid Sequences MSDDSGVLFVGSRPRKRTHREISEVSEVSSGRPSGEPSSSSLSATPGPSLPPLRRYPGDGLDLRRPATSQPSEDVIDLTDEPDTPYQNSSLQESRTTTEASRPRPPRFPRDILTEVVDLEEEVDDNDQQQPPSSPEVEFIGATVRRPQLPPPPQPPPPPPPRNNEGFYMPSLWQQMLQFRSPRPPGRFGDHGRPDLSFRGFRRHPPMSDVESLWIGDGPAGAIDLTINLDVDGPLGLDYQLTGLTRQRTPANAYKPPSPPPEGFTRNVAEDDVVVCPNCDMELGTGDETKQQIWVVKQCGHVRDTPELRLAQPSSNLDRRCIVATVPPTDRCRRRKRTLRKPSLSLNARYSVAESP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.55
3 0.63
4 0.72
5 0.73
6 0.76
7 0.78
8 0.79
9 0.78
10 0.77
11 0.69
12 0.6
13 0.52
14 0.41
15 0.34
16 0.31
17 0.24
18 0.17
19 0.17
20 0.19
21 0.2
22 0.22
23 0.22
24 0.22
25 0.29
26 0.28
27 0.28
28 0.25
29 0.24
30 0.24
31 0.23
32 0.21
33 0.15
34 0.16
35 0.2
36 0.24
37 0.26
38 0.3
39 0.33
40 0.38
41 0.39
42 0.42
43 0.43
44 0.42
45 0.46
46 0.43
47 0.44
48 0.45
49 0.47
50 0.43
51 0.38
52 0.34
53 0.29
54 0.34
55 0.32
56 0.27
57 0.27
58 0.29
59 0.3
60 0.3
61 0.28
62 0.19
63 0.18
64 0.15
65 0.13
66 0.1
67 0.09
68 0.1
69 0.11
70 0.12
71 0.11
72 0.12
73 0.13
74 0.16
75 0.17
76 0.2
77 0.22
78 0.22
79 0.24
80 0.25
81 0.25
82 0.24
83 0.24
84 0.2
85 0.25
86 0.3
87 0.33
88 0.4
89 0.46
90 0.49
91 0.57
92 0.63
93 0.64
94 0.66
95 0.66
96 0.6
97 0.61
98 0.59
99 0.51
100 0.48
101 0.39
102 0.3
103 0.25
104 0.2
105 0.12
106 0.09
107 0.07
108 0.04
109 0.04
110 0.05
111 0.05
112 0.06
113 0.09
114 0.09
115 0.09
116 0.1
117 0.12
118 0.13
119 0.16
120 0.17
121 0.14
122 0.14
123 0.16
124 0.16
125 0.14
126 0.12
127 0.13
128 0.12
129 0.12
130 0.16
131 0.15
132 0.16
133 0.17
134 0.21
135 0.26
136 0.34
137 0.41
138 0.43
139 0.48
140 0.51
141 0.56
142 0.59
143 0.57
144 0.6
145 0.61
146 0.6
147 0.59
148 0.59
149 0.59
150 0.55
151 0.49
152 0.41
153 0.34
154 0.3
155 0.26
156 0.22
157 0.19
158 0.17
159 0.15
160 0.13
161 0.12
162 0.16
163 0.15
164 0.17
165 0.18
166 0.18
167 0.25
168 0.28
169 0.34
170 0.34
171 0.38
172 0.38
173 0.41
174 0.46
175 0.44
176 0.49
177 0.47
178 0.45
179 0.4
180 0.38
181 0.34
182 0.3
183 0.29
184 0.24
185 0.2
186 0.26
187 0.27
188 0.31
189 0.38
190 0.39
191 0.37
192 0.37
193 0.41
194 0.37
195 0.38
196 0.33
197 0.27
198 0.23
199 0.22
200 0.18
201 0.13
202 0.08
203 0.06
204 0.05
205 0.04
206 0.03
207 0.03
208 0.03
209 0.03
210 0.03
211 0.03
212 0.03
213 0.04
214 0.04
215 0.04
216 0.04
217 0.04
218 0.04
219 0.04
220 0.04
221 0.04
222 0.04
223 0.04
224 0.04
225 0.04
226 0.04
227 0.05
228 0.05
229 0.06
230 0.1
231 0.13
232 0.14
233 0.17
234 0.19
235 0.2
236 0.26
237 0.33
238 0.37
239 0.4
240 0.43
241 0.48
242 0.49
243 0.53
244 0.52
245 0.49
246 0.43
247 0.4
248 0.45
249 0.43
250 0.41
251 0.4
252 0.37
253 0.33
254 0.32
255 0.29
256 0.2
257 0.16
258 0.15
259 0.13
260 0.11
261 0.1
262 0.09
263 0.08
264 0.08
265 0.08
266 0.07
267 0.06
268 0.06
269 0.08
270 0.1
271 0.11
272 0.11
273 0.12
274 0.15
275 0.15
276 0.14
277 0.13
278 0.12
279 0.15
280 0.19
281 0.25
282 0.28
283 0.32
284 0.39
285 0.42
286 0.45
287 0.44
288 0.44
289 0.41
290 0.46
291 0.45
292 0.41
293 0.41
294 0.38
295 0.37
296 0.39
297 0.36
298 0.29
299 0.31
300 0.33
301 0.36
302 0.42
303 0.42
304 0.39
305 0.39
306 0.38
307 0.36
308 0.32
309 0.25
310 0.25
311 0.29
312 0.33
313 0.36
314 0.4
315 0.43
316 0.52
317 0.61
318 0.64
319 0.7
320 0.74
321 0.8
322 0.85
323 0.9
324 0.92
325 0.94
326 0.95
327 0.93
328 0.9
329 0.88
330 0.87
331 0.84
332 0.79
333 0.73
334 0.66
335 0.58
336 0.51