Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A2R0D3

Protein Details
Accession A2R0D3    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
66-87SGNCTAHHHHHNRHHHHHRHQPBasic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto 9, mito 2, plas 1, pero 1, golg 1
Family & Domain DBs
Amino Acid Sequences MEKNASSMQAITDWPRRLGLFVHHHFSQISFETIDFVTKPDIYVHALLLLSCSVCRPHSGRISLVSGNCTAHHHHHNRHHHHHRHQP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.26
4 0.25
5 0.25
6 0.28
7 0.3
8 0.31
9 0.36
10 0.34
11 0.34
12 0.33
13 0.32
14 0.27
15 0.19
16 0.17
17 0.12
18 0.11
19 0.12
20 0.12
21 0.12
22 0.09
23 0.09
24 0.09
25 0.08
26 0.09
27 0.08
28 0.09
29 0.1
30 0.1
31 0.09
32 0.09
33 0.09
34 0.08
35 0.08
36 0.07
37 0.05
38 0.05
39 0.05
40 0.06
41 0.06
42 0.09
43 0.11
44 0.18
45 0.24
46 0.26
47 0.27
48 0.29
49 0.33
50 0.33
51 0.31
52 0.27
53 0.22
54 0.21
55 0.2
56 0.19
57 0.19
58 0.22
59 0.31
60 0.37
61 0.45
62 0.54
63 0.64
64 0.71
65 0.79
66 0.84
67 0.85