Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395M9C0

Protein Details
Accession A0A395M9C0    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
201-220KQENGKTPKKEKKAVSPAAGHydrophilic
NLS Segment(s)
PositionSequence
206-226KTPKKEKKAVSPAAGKTARKT
Subcellular Location(s) cyto 19.5, cyto_nucl 13.333, nucl 6, mito_nucl 3.833
Family & Domain DBs
Amino Acid Sequences MSDGIAPAIDKVGAPEPTAPEAEAGAPTLDTTTAPSETAKPEESKPTDGAGGLHAPPKPVEVASVPETPVNNMTPAGGTPRPVLNIEEETKETPKNEDEVAFVTTGVETTSAPTVSEPKDVTMTDNPASVNGDSKPEVNDPAEAAAGEKRKADEPPAATNGASAPVVAEKSGSDEPAEKKARVEDVADEPTASEEASPDGKQENGKTPKKEKKAVSPAAGKTARKTRSQGPVEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.19
3 0.21
4 0.23
5 0.24
6 0.21
7 0.16
8 0.16
9 0.16
10 0.13
11 0.11
12 0.09
13 0.08
14 0.08
15 0.08
16 0.07
17 0.06
18 0.08
19 0.1
20 0.1
21 0.11
22 0.13
23 0.15
24 0.18
25 0.21
26 0.22
27 0.22
28 0.24
29 0.33
30 0.35
31 0.36
32 0.34
33 0.32
34 0.3
35 0.28
36 0.25
37 0.18
38 0.18
39 0.15
40 0.17
41 0.16
42 0.16
43 0.16
44 0.16
45 0.15
46 0.12
47 0.13
48 0.11
49 0.15
50 0.18
51 0.19
52 0.19
53 0.19
54 0.2
55 0.19
56 0.2
57 0.16
58 0.12
59 0.11
60 0.11
61 0.09
62 0.09
63 0.13
64 0.12
65 0.12
66 0.13
67 0.14
68 0.15
69 0.16
70 0.16
71 0.14
72 0.18
73 0.18
74 0.18
75 0.19
76 0.19
77 0.2
78 0.2
79 0.18
80 0.16
81 0.16
82 0.16
83 0.15
84 0.14
85 0.13
86 0.14
87 0.14
88 0.12
89 0.11
90 0.09
91 0.08
92 0.07
93 0.06
94 0.05
95 0.04
96 0.04
97 0.05
98 0.05
99 0.05
100 0.06
101 0.09
102 0.09
103 0.12
104 0.11
105 0.11
106 0.12
107 0.12
108 0.15
109 0.14
110 0.16
111 0.14
112 0.15
113 0.14
114 0.13
115 0.14
116 0.12
117 0.12
118 0.09
119 0.11
120 0.1
121 0.11
122 0.12
123 0.12
124 0.14
125 0.13
126 0.13
127 0.11
128 0.11
129 0.1
130 0.08
131 0.08
132 0.1
133 0.11
134 0.11
135 0.11
136 0.12
137 0.14
138 0.15
139 0.17
140 0.2
141 0.21
142 0.26
143 0.28
144 0.27
145 0.25
146 0.24
147 0.22
148 0.18
149 0.14
150 0.09
151 0.06
152 0.06
153 0.07
154 0.06
155 0.06
156 0.05
157 0.1
158 0.11
159 0.11
160 0.11
161 0.15
162 0.18
163 0.27
164 0.3
165 0.26
166 0.27
167 0.29
168 0.32
169 0.29
170 0.28
171 0.23
172 0.25
173 0.27
174 0.26
175 0.23
176 0.2
177 0.2
178 0.18
179 0.14
180 0.09
181 0.06
182 0.08
183 0.11
184 0.11
185 0.11
186 0.12
187 0.15
188 0.18
189 0.21
190 0.3
191 0.37
192 0.44
193 0.51
194 0.6
195 0.68
196 0.74
197 0.79
198 0.75
199 0.76
200 0.8
201 0.8
202 0.78
203 0.76
204 0.7
205 0.71
206 0.71
207 0.61
208 0.57
209 0.58
210 0.55
211 0.52
212 0.55
213 0.53
214 0.58