Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395MEZ0

Protein Details
Accession A0A395MEZ0    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPISKKDRRNKEHKRADAAGBasic
NLS Segment(s)
PositionSequence
5-20KKDRRNKEHKRADAAG
Subcellular Location(s) nucl 19.5, mito_nucl 13.833, cyto_nucl 11.166, mito 6
Family & Domain DBs
Amino Acid Sequences MPISKKDRRNKEHKRADAAGTRAPVKANGLPVKAPKPTSICQNCRKEIVNTNKLQLEVHASTHDAKLWPKEKCWPNDFQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.79
3 0.76
4 0.72
5 0.64
6 0.57
7 0.49
8 0.42
9 0.35
10 0.31
11 0.25
12 0.21
13 0.2
14 0.22
15 0.23
16 0.23
17 0.24
18 0.26
19 0.29
20 0.28
21 0.27
22 0.23
23 0.25
24 0.25
25 0.33
26 0.38
27 0.42
28 0.49
29 0.54
30 0.53
31 0.51
32 0.52
33 0.46
34 0.47
35 0.5
36 0.49
37 0.44
38 0.46
39 0.44
40 0.42
41 0.38
42 0.3
43 0.27
44 0.19
45 0.19
46 0.17
47 0.17
48 0.18
49 0.19
50 0.2
51 0.16
52 0.18
53 0.25
54 0.32
55 0.33
56 0.34
57 0.44
58 0.5
59 0.57