FuNGI

A0A395MZH8

Protein Details

Accession

A0A395MZH8

Localization Confidence

Low

Confidence Score

8.6

NoLS Segment(s)

Position	Sequence	Protein Nature
400-421	ALKKHAEKSPRNKKGPPRAPRY	Basic

NLS Segment(s)

Position	Sequence
402-419	KKHAEKSPRNKKGPPRAP

Subcellular Location(s)

cyto 13, cyto_nucl 8.5, mito 8, nucl 2, E.R. 2

Family & Domain DBs

InterPro	View protein in InterPro IPR045260 Sec12-like IPR015943 WD40/YVTN_repeat-like_dom_sf
Gene Ontology	GO:0005789 C:endoplasmic reticulum membrane GO:0000139 C:Golgi membrane GO:0005096 F:GTPase activator activity GO:0005085 F:guanyl-nucleotide exchange factor activity GO:0006888 P:endoplasmic reticulum to Golgi vesicle-mediated transport GO:0009306 P:protein secretion GO:0003400 P:regulation of COPII vesicle coating

Amino Acid Sequences

MASLFPRSSIELDYPLYAVDFDPEDANRVVVGGGGGASKTGVGNKITVLETVSQHELRSAGEITLSRDEDSVMSLAVGPHKGKTTYVYAGVNSSPESLAQGKNEHLRALSVDPSKLRTSVGAKTPDANITEASRTSLFKNPDIDTYQRLLRIAGSTGAAATAMGREPQLAIFDVAGPVAKLRGLLELEKEAEDLDIVQTGDNDFQVAYCSKYELYLVDINGKEVSEPRKVYTMKDDHGERPAFRAIRYLSPSFLAAASNLPKRSGVIVQAFRLPKEDAAEARLSINARIPRKISATALAVTNLSPPASPFGSIGDTQFVIAVAGHDSSITLYTLEHSVGGNVELLAKLWHLHTLKEVHGADNITGLAFSHFTTPKNNLRQQYIKLASTSLQKTVAVHSIALKKHAEKSPRNKKGPPRAPRYVTAKDSREVSSSGLYITMAILALVMAIVAQGVLELYGGSPPILGAQKAFPQYGTLRTPDHPPVAFLADEFLAKLAGRDVVKTVTGETLVVYEGDVAPATAGGDAQAPELKLDVHDPSVHGPGKTWEELGEEQKEAWKARLKETGAWTQTMGEAIFKGILFGEIAGAVGRAVAG

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.21
2	0.19
3	0.17
4	0.15
5	0.12
6	0.11
7	0.1
8	0.1
9	0.13
10	0.13
11	0.16
12	0.16
13	0.16
14	0.14
15	0.13
16	0.12
17	0.09
18	0.09
19	0.05
20	0.06
21	0.06
22	0.06
23	0.06
24	0.06
25	0.06
26	0.06
27	0.09
28	0.12
29	0.12
30	0.14
31	0.14
32	0.18
33	0.18
34	0.18
35	0.17
36	0.17
37	0.18
38	0.21
39	0.25
40	0.22
41	0.22
42	0.23
43	0.21
44	0.18
45	0.2
46	0.17
47	0.12
48	0.14
49	0.15
50	0.18
51	0.23
52	0.23
53	0.21
54	0.2
55	0.2
56	0.18
57	0.19
58	0.15
59	0.1
60	0.09
61	0.09
62	0.1
63	0.12
64	0.15
65	0.14
66	0.15
67	0.18
68	0.19
69	0.19
70	0.22
71	0.25
72	0.25
73	0.28
74	0.28
75	0.26
76	0.27
77	0.27
78	0.24
79	0.19
80	0.17
81	0.13
82	0.11
83	0.14
84	0.14
85	0.16
86	0.17
87	0.19
88	0.22
89	0.28
90	0.29
91	0.27
92	0.24
93	0.23
94	0.23
95	0.23
96	0.26
97	0.22
98	0.24
99	0.24
100	0.28
101	0.29
102	0.27
103	0.25
104	0.22
105	0.23
106	0.27
107	0.33
108	0.34
109	0.34
110	0.36
111	0.37
112	0.36
113	0.33
114	0.28
115	0.22
116	0.19
117	0.2
118	0.18
119	0.19
120	0.17
121	0.17
122	0.19
123	0.24
124	0.25
125	0.26
126	0.31
127	0.3
128	0.32
129	0.35
130	0.34
131	0.32
132	0.32
133	0.31
134	0.27
135	0.26
136	0.22
137	0.2
138	0.19
139	0.16
140	0.14
141	0.12
142	0.1
143	0.1
144	0.09
145	0.08
146	0.06
147	0.05
148	0.05
149	0.05
150	0.05
151	0.05
152	0.06
153	0.06
154	0.07
155	0.08
156	0.08
157	0.08
158	0.08
159	0.08
160	0.08
161	0.07
162	0.07
163	0.06
164	0.05
165	0.05
166	0.05
167	0.05
168	0.05
169	0.08
170	0.09
171	0.1
172	0.12
173	0.13
174	0.14
175	0.14
176	0.14
177	0.11
178	0.1
179	0.09
180	0.07
181	0.05
182	0.06
183	0.06
184	0.06
185	0.06
186	0.06
187	0.07
188	0.06
189	0.06
190	0.05
191	0.05
192	0.07
193	0.07
194	0.08
195	0.08
196	0.09
197	0.09
198	0.1
199	0.1
200	0.08
201	0.12
202	0.13
203	0.13
204	0.17
205	0.17
206	0.18
207	0.17
208	0.17
209	0.13
210	0.14
211	0.17
212	0.17
213	0.19
214	0.19
215	0.25
216	0.26
217	0.28
218	0.33
219	0.35
220	0.31
221	0.34
222	0.36
223	0.32
224	0.38
225	0.38
226	0.29
227	0.27
228	0.3
229	0.27
230	0.23
231	0.26
232	0.22
233	0.25
234	0.29
235	0.27
236	0.23
237	0.23
238	0.23
239	0.19
240	0.17
241	0.12
242	0.08
243	0.09
244	0.12
245	0.15
246	0.15
247	0.15
248	0.14
249	0.15
250	0.16
251	0.15
252	0.15
253	0.18
254	0.2
255	0.2
256	0.26
257	0.26
258	0.24
259	0.25
260	0.22
261	0.16
262	0.16
263	0.16
264	0.11
265	0.14
266	0.14
267	0.12
268	0.12
269	0.13
270	0.11
271	0.1
272	0.14
273	0.16
274	0.17
275	0.19
276	0.2
277	0.2
278	0.22
279	0.23
280	0.2
281	0.17
282	0.18
283	0.17
284	0.16
285	0.14
286	0.12
287	0.1
288	0.1
289	0.08
290	0.06
291	0.05
292	0.05
293	0.07
294	0.07
295	0.08
296	0.07
297	0.08
298	0.1
299	0.1
300	0.1
301	0.09
302	0.09
303	0.08
304	0.08
305	0.07
306	0.05
307	0.05
308	0.05
309	0.04
310	0.04
311	0.04
312	0.04
313	0.04
314	0.04
315	0.05
316	0.04
317	0.04
318	0.04
319	0.05
320	0.06
321	0.06
322	0.06
323	0.05
324	0.06
325	0.06
326	0.06
327	0.05
328	0.05
329	0.05
330	0.04
331	0.05
332	0.05
333	0.05
334	0.05
335	0.05
336	0.1
337	0.1
338	0.11
339	0.14
340	0.16
341	0.17
342	0.23
343	0.23
344	0.19
345	0.2
346	0.2
347	0.17
348	0.15
349	0.14
350	0.08
351	0.07
352	0.06
353	0.05
354	0.05
355	0.06
356	0.09
357	0.11
358	0.12
359	0.15
360	0.21
361	0.28
362	0.36
363	0.41
364	0.4
365	0.45
366	0.5
367	0.5
368	0.54
369	0.49
370	0.42
371	0.37
372	0.34
373	0.3
374	0.32
375	0.3
376	0.22
377	0.2
378	0.19
379	0.19
380	0.2
381	0.22
382	0.16
383	0.15
384	0.18
385	0.22
386	0.23
387	0.25
388	0.25
389	0.23
390	0.29
391	0.34
392	0.38
393	0.41
394	0.52
395	0.6
396	0.69
397	0.73
398	0.73
399	0.79
400	0.82
401	0.83
402	0.82
403	0.79
404	0.78
405	0.76
406	0.76
407	0.74
408	0.69
409	0.65
410	0.63
411	0.57
412	0.5
413	0.49
414	0.43
415	0.37
416	0.31
417	0.27
418	0.2
419	0.18
420	0.15
421	0.13
422	0.11
423	0.09
424	0.08
425	0.06
426	0.05
427	0.04
428	0.04
429	0.03
430	0.03
431	0.03
432	0.02
433	0.02
434	0.02
435	0.02
436	0.02
437	0.02
438	0.02
439	0.02
440	0.02
441	0.02
442	0.02
443	0.03
444	0.03
445	0.04
446	0.04
447	0.04
448	0.04
449	0.07
450	0.09
451	0.09
452	0.09
453	0.12
454	0.17
455	0.19
456	0.2
457	0.17
458	0.19
459	0.21
460	0.25
461	0.26
462	0.24
463	0.25
464	0.26
465	0.32
466	0.33
467	0.36
468	0.3
469	0.28
470	0.28
471	0.27
472	0.25
473	0.2
474	0.17
475	0.13
476	0.13
477	0.12
478	0.09
479	0.07
480	0.07
481	0.08
482	0.07
483	0.11
484	0.11
485	0.12
486	0.13
487	0.15
488	0.16
489	0.16
490	0.16
491	0.13
492	0.13
493	0.12
494	0.11
495	0.1
496	0.09
497	0.08
498	0.07
499	0.07
500	0.07
501	0.07
502	0.07
503	0.06
504	0.05
505	0.06
506	0.06
507	0.05
508	0.04
509	0.04
510	0.06
511	0.07
512	0.08
513	0.1
514	0.1
515	0.1
516	0.11
517	0.11
518	0.1
519	0.13
520	0.13
521	0.14
522	0.15
523	0.16
524	0.19
525	0.26
526	0.27
527	0.25
528	0.24
529	0.27
530	0.31
531	0.31
532	0.29
533	0.22
534	0.25
535	0.28
536	0.33
537	0.31
538	0.26
539	0.25
540	0.29
541	0.32
542	0.29
543	0.31
544	0.34
545	0.34
546	0.4
547	0.48
548	0.46
549	0.49
550	0.54
551	0.58
552	0.52
553	0.51
554	0.45
555	0.37
556	0.35
557	0.29
558	0.23
559	0.14
560	0.12
561	0.11
562	0.13
563	0.11
564	0.11
565	0.09
566	0.1
567	0.09
568	0.08
569	0.08
570	0.06
571	0.07
572	0.06
573	0.06
574	0.05

A0A395MZH8

3D AlphaFold-predicted Structure Viewer