Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LSA9

Protein Details
Accession E2LSA9   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-58GAGATSPKQKRGPRHCKKCPGNILQTDCFEHGAKHARARRLRQKQNATQSQDPHydrophilic
NLS Segment(s)
PositionSequence
184-196IRARKSILHEKKI
Subcellular Location(s) nucl 11.5, cyto_nucl 9.5, mito 9, cyto 6.5
Family & Domain DBs
KEGG mpr:MPER_09914  -  
Amino Acid Sequences MVKAEGAGATSPKQKRGPRHCKKCPGNILQTDCFEHGAKHARARRLRQKQNATQSQDPAQASLVPVEPQNPVPATPPAVRQEAPPPVYESRSGACHSPVIDPILLEESTFPLPDPTKDVPLQHEGIPVNTVLAAPESPPSISVSHTTGSGRIAKIRIRPSQSNPTYGLVDGVLRGTTEWRIPRIRARKSILHEKKIHKRFDEKVTAIANRCEELGDETGAWVQFSAHFPGARHGAVQYFSKRFRKEAPQGVEDLMVLSGKVFKALVNSRRKDVVQAELEIAHLRAQAEAAHAAEASSKADVAALTRTNEMQSDIISQLHRDLQYTRRDRPGSGRHAIPAGRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.56
3 0.65
4 0.73
5 0.76
6 0.84
7 0.88
8 0.9
9 0.93
10 0.92
11 0.91
12 0.9
13 0.88
14 0.85
15 0.82
16 0.76
17 0.69
18 0.62
19 0.53
20 0.45
21 0.36
22 0.28
23 0.26
24 0.31
25 0.31
26 0.37
27 0.42
28 0.49
29 0.57
30 0.66
31 0.72
32 0.74
33 0.81
34 0.83
35 0.86
36 0.87
37 0.89
38 0.89
39 0.85
40 0.79
41 0.73
42 0.67
43 0.63
44 0.54
45 0.43
46 0.35
47 0.28
48 0.23
49 0.21
50 0.17
51 0.12
52 0.12
53 0.13
54 0.14
55 0.14
56 0.17
57 0.15
58 0.15
59 0.17
60 0.18
61 0.21
62 0.21
63 0.26
64 0.26
65 0.29
66 0.28
67 0.28
68 0.33
69 0.36
70 0.36
71 0.32
72 0.33
73 0.31
74 0.33
75 0.32
76 0.27
77 0.21
78 0.23
79 0.22
80 0.19
81 0.18
82 0.18
83 0.18
84 0.17
85 0.17
86 0.16
87 0.15
88 0.14
89 0.13
90 0.14
91 0.13
92 0.11
93 0.1
94 0.1
95 0.1
96 0.1
97 0.09
98 0.1
99 0.11
100 0.11
101 0.17
102 0.17
103 0.21
104 0.22
105 0.24
106 0.25
107 0.28
108 0.29
109 0.24
110 0.26
111 0.22
112 0.21
113 0.2
114 0.16
115 0.12
116 0.1
117 0.09
118 0.05
119 0.05
120 0.05
121 0.05
122 0.06
123 0.06
124 0.06
125 0.07
126 0.08
127 0.08
128 0.09
129 0.1
130 0.11
131 0.11
132 0.12
133 0.12
134 0.11
135 0.12
136 0.15
137 0.13
138 0.14
139 0.16
140 0.18
141 0.24
142 0.3
143 0.33
144 0.36
145 0.4
146 0.43
147 0.52
148 0.5
149 0.47
150 0.43
151 0.39
152 0.34
153 0.3
154 0.24
155 0.13
156 0.12
157 0.09
158 0.07
159 0.05
160 0.04
161 0.04
162 0.05
163 0.05
164 0.08
165 0.09
166 0.13
167 0.15
168 0.17
169 0.25
170 0.34
171 0.39
172 0.43
173 0.46
174 0.49
175 0.53
176 0.63
177 0.62
178 0.61
179 0.63
180 0.65
181 0.7
182 0.72
183 0.71
184 0.63
185 0.62
186 0.59
187 0.6
188 0.6
189 0.5
190 0.47
191 0.46
192 0.46
193 0.4
194 0.37
195 0.29
196 0.21
197 0.2
198 0.15
199 0.12
200 0.12
201 0.12
202 0.1
203 0.09
204 0.09
205 0.1
206 0.1
207 0.09
208 0.07
209 0.05
210 0.07
211 0.09
212 0.12
213 0.12
214 0.13
215 0.14
216 0.17
217 0.19
218 0.17
219 0.16
220 0.14
221 0.14
222 0.15
223 0.18
224 0.21
225 0.23
226 0.3
227 0.36
228 0.38
229 0.39
230 0.44
231 0.5
232 0.54
233 0.58
234 0.58
235 0.53
236 0.53
237 0.51
238 0.44
239 0.34
240 0.26
241 0.16
242 0.1
243 0.07
244 0.06
245 0.07
246 0.06
247 0.07
248 0.07
249 0.07
250 0.13
251 0.22
252 0.3
253 0.38
254 0.41
255 0.44
256 0.48
257 0.48
258 0.47
259 0.42
260 0.41
261 0.35
262 0.34
263 0.32
264 0.28
265 0.29
266 0.24
267 0.21
268 0.14
269 0.12
270 0.1
271 0.09
272 0.09
273 0.09
274 0.1
275 0.12
276 0.11
277 0.1
278 0.09
279 0.09
280 0.1
281 0.1
282 0.09
283 0.08
284 0.08
285 0.07
286 0.08
287 0.08
288 0.08
289 0.12
290 0.14
291 0.15
292 0.17
293 0.18
294 0.18
295 0.19
296 0.2
297 0.16
298 0.14
299 0.16
300 0.15
301 0.17
302 0.17
303 0.17
304 0.18
305 0.23
306 0.22
307 0.21
308 0.24
309 0.28
310 0.38
311 0.44
312 0.48
313 0.52
314 0.54
315 0.55
316 0.61
317 0.64
318 0.62
319 0.62
320 0.59
321 0.52
322 0.55